SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P08560_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P08560_001
Domain Number 1 Region: 160-421
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.67e-58
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 39-123
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.54e-21
Family Ankyrin repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P08560_001
Sequence length 462
Comment pep:novel chromosome:MA1:8:5758568:5765226:-1 gene:GSMUA_Achr8G08560_001 transcript:GSMUA_Achr8T08560_001 description:"serine/threonine protein kinase, putative, expressed"
Sequence
MEAAKQLKRGISRQLSGGSVRRSGRFSFKRNLSFDPRLSNGDAKGVEELMENGVDVNSID
LDGRTALHIAACEGHIGVVKLLLSWRANIDARDRWGSTAAADAKYYGNVEVYSILKARGA
KVPKTRRTPMAVSNPQEVPEYELNPGELQFRRGEEDTYQVAKWNGTKVSVKILDRESYSD
PDRVNAFKYELNLLQRARHPNVIQFVGAVTQNIPMMIVSEYHPKGDLGSYLHKKGRLQPH
KVIRYALEIARGMNYLHQCKPDPIIHCNLKPKNILLDCGGQLKVGGFGLVNLSKISPNKA
KLADSKAQIDNLSKLSNRIRSIKTKFLGLYMAPEVYRDEIFDRSVDAFSFGLILYEMIEG
APAFHPKGPEEAARMICLDGLRPLMKNKSKGYPLDVKELIEECWDPDPVVRPTFSEIIIR
LDKVYATCLKQGRWKDTFKLPWYAPIFSKIMMIHSCAMFLNI
Download sequence
Identical sequences M0TNQ9
GSMUA_Achr8P08560_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]