SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P09410_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P09410_001
Domain Number 1 Region: 213-335
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.22e-33
Family Ankyrin repeat 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P09410_001
Sequence length 341
Comment pep:novel chromosome:MA1:8:6585216:6591890:1 gene:GSMUA_Achr8G09410_001 transcript:GSMUA_Achr8T09410_001 description:"Ankyrin repeat domain-containing protein 2"
Sequence
MASGNQEGKTGSDENKTSAAEASSTQQQAGRRRTTSTPATGFPTNPFDFSSMQNLLNDPT
IKEMAEQIAQDPVFSQIAEQLQKSVHSAGQEDVPSLDPQQYMSTIQQVMQNPQFTKMAEH
LGNAIMQDPVMSSVLENLSNPAQKEQMEERMAHMKEDPSLKAILEEIESGGPSTMMKYWN
DPEVLQKIGSAMGIAPSGDGATSTEQLGPEETEDDEEESVVHHTASIGDVEGLKKALDSG
ADKDEEDSEGRRPLHFACGYGEVKCAQILLEAGAAVDALDKNKNTPLHYAAGYGRKECVG
LLLEHGAAVTLQNLDKKTPIDVAKLNDQHEVLKLLEKDVFL
Download sequence
Identical sequences M0TNZ4
XP_009411775.1.42102 GSMUA_Achr8P09410_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]