SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P09740_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P09740_001
Domain Number 1 Region: 372-429
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.88e-16
Family PHD domain 0.0042
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr8P09740_001
Domain Number - Region: 3-44
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0677
Family Tudor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P09740_001
Sequence length 1150
Comment pep:novel chromosome:MA1:8:6840988:6848782:1 gene:GSMUA_Achr8G09740_001 transcript:GSMUA_Achr8T09740_001 description:"Putative PHD-finger family protein, expressed"
Sequence
MELVGRTVKKIFPGFGTFSGVVKSYDPSAGYFKVLYEDGDSEELDYGEIASMLMEMGEEA
SPMGQNQNNNRSRWSKKRTSGELDLPEDVDLGSGKVVGVSLIGEDGELSEQNGLFQGSGG
KESDLGDADERSARRASAAALCPSDPLHSHILKSESEFQNCLLDEKDRHVVPEDSKPELP
PSSSDLDLNGLPILDFFSVYTLLRSFSRVLFLSPFSLPMFLSALRCEFPNSLIDHIHFSI
LQTLKQHLELLSEEGYQPATDSLRTLNWELLDLVTWPVYLAGYSLIHGSTMKSLVKLTHP
NIMAAEYYMQPASVKLEMLRCLCDDVMEVDGMRSELNIRLTDCEINVDAYNNVYKNRIGL
AITGLEASLVQEMPEETADGNSDDCCLCGMDGSLICCDGCPAAFHSRCVGVAKDLLPEGD
WYCPECLMDKRDGLTKLSKTSRGAEVLGIDPHGRLYFSSCGYLLVSDSCESVSSSHFYNK
DDLEILIRVLKSSHASYTAIVNTISAQWGISLDSHSSISQSCHEIINRNEALDSQLNLLS
SDPNVVNDDIVKNSKDNCTNSEHSDPISANASDLSQTNLVSLDHASGMSLLFVSSEPAEQ
LAHAVNYLQSTQQTTDSCSIATDNPVDEVISVTPVVISTDNSKHFAITDLGGTSFISEQV
QKKAETCKLQSDPCGYINYYIFGRVASSVAEDLMIKSSESNNKEPKKSDEDMVVAQLKAI
FKRCPKLSSYSFLQQSLDIQKEKCGWCHSCKTSSSSDCAFVVNDKHIEDMKSDAVGLDSE
KKKKSHIVSVMHDILSIEDHLNGLLSGPWDNPHYSSLWRKAVMKASDVASLKHMLLLLES
NLRRVAMLSDWMKPVDFAHTVGSASHILIGSMDAFSNCGGSRKQGKRTTSGSEFNISQAA
AASYVCWWRGGRLSRRVFHWKMLPRSLTSKGGRQAGCKKISNVFYPDVPEFARRNKFITW
RAAVEMSETVAQLAFLTKEFDSNIRWLELCKTPPFPQLIKESKGLARLFKKVIIRRKSIE
GAIVRYLLDFGKRENIPSTVIRYGVIHEDPSSERKKFWLGENYVPLYLIKAFEAKKLARS
IKKTGSKLLSHDVVDFGSKKPERSIGLSYLISKAEKMEAKLCGQCNKNVPIREAVNCQLC
NGMYYELIYL
Download sequence
Identical sequences M0TP27
GSMUA_Achr8P09740_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]