SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P16360_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P16360_001
Domain Number 1 Region: 326-644
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.81e-50
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 104-354
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.06e-20
Family Ankyrin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 1015-1095
Classification Level Classification E-value
Superfamily RNI-like 0.00000053
Family 28-residue LRR 0.075
Further Details:      
 
Domain Number 4 Region: 961-1006
Classification Level Classification E-value
Superfamily F-box domain 0.00000406
Family F-box domain 0.0039
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr8P16360_001
Domain Number - Region: 663-764
Classification Level Classification E-value
Superfamily PH domain-like 0.00738
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P16360_001
Sequence length 1222
Comment pep:novel chromosome:MA1:8:14170379:14183268:1 gene:GSMUA_Achr8G16360_001 transcript:GSMUA_Achr8T16360_001 description:"Putative F-box protein SKIP14"
Sequence
MTVFAHSMGRGSEGAAGGVAVTMKGAAGRLQVHPLPDYGAEASQRLVEVAQRGDAREVAE
SLADPAVDVNFAGAVCLRARRATVSLREEAADEVLVEYEEIRTDASALFLAAHAGDLLVV
RKLLEKGADVNQKLFRGHAITAAVREGQTEVVEALLKAGASQPACEEAVVEASLHGRASL
AEFLIGTDLVRPRVAVHALVLAASRGFLDVVDTLIKCGADPNATSRVLLRSLKPSLHTNV
DGTALIAAIVSRQTAVVRRLLQAGVRKDAKVRLGAWSWDTTTGEEFRVGAGLAEPYTAAW
CAVEYFESAGTILRMLLQHHSLNAPHCGRTLLHHAILCANPRAVDTLLACGADCELPVKT
SRKTEFRPIHMTVRLGLASILQILIDKGCDLNSRTDTGETALMLCARYNRDDCLRILVTA
GADLGLVSVAGVSATKAAACSHWSISFQRVVVDLIRAGTVPRSSNPSVFSPIMFAALCGD
VGSLEVLLTRPDIDIDGQDEEGYSPLMAAAKEGHVNVFRVLVFAGANAKLCNKAGETAID
LSRSKENRDLFEQVMLEFTLERGSAGGFYALHFAARRGDMAAARLLTKRGCDVNAVDGDG
YTPLMLAAREGHAEVCQLLIHGGAKCDAKTHRGETALSLARSNAKLGKDAENVILDELAM
ALVLRGGHVKKHTKCGRGSPHGKVLRMAAEAGVLQWGKASRRNVVCREAEVGGSSAFQRN
RKGKGDRREAGLFRVVTAGKREVHFVCGGGEEAAQLWVRGIRLVTRAASGNGSSNSTAAL
LDQNSFDSEGGLNDRKLRCFRVLVRVGMALNFSSCSIFSTAFVTDDEFCRPRCERSQPFS
YPFSSGWENGNGYGWDSGSTGVDGACDPVDLLPDDPFGMGIDGALASFLEVGGGDLYGWA
LLCSPETEIYHDGWMDELDGWAEESFMVASVHEAQDGNLESALDMQKSLNSDRAAEAHSS
VDEGLPHEGLLYSLGYLGIHDLLSVEGVCRSLRLAVQNDALLWRCIHIDSLLGEKITDDV
LLRLTQRAQGNLQCLSLSGCSRITDDGVKCVLDNNPKLKKLSVAGCVRLSLDGIINNLKA
FRSQGTPGIEHLKLGRLFSISGEQFGALKLLLGIDQHQQAQAQKPRFYHTSDSSLVCDDD
CIIDVEMCPVCQKYKLVYDCPSEGCQEKGPKHCRACDFCIARCIQCGKCIKDCMYVETFC
LEYLCSGCWKEALAEHRSNEEK
Download sequence
Identical sequences M0TQY9
GSMUA_Achr8P16360_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]