SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P16840_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P16840_001
Domain Number 1 Region: 44-130
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.46e-19
Family Ankyrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P16840_001
Sequence length 139
Comment pep:novel chromosome:MA1:8:14911451:14912904:1 gene:GSMUA_Achr8G16840_001 transcript:GSMUA_Achr8T16840_001 description:"Integrin-linked protein kinase"
Sequence
MSSEEGNPIGDGGGEGEGASSGASPPRTGEKQKEKARVSRTSLILWHAHQNDAAAVRKLL
EEDRGLVNARDYDSRTPLHVAALHGWINVTGCLLEYGADVNAQDRWNNTPLADAEGAKQH
GMIELLKAHGGMSFVRLLQ
Download sequence
Identical sequences M0TR37
GSMUA_Achr8P16840_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]