SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P20280_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P20280_001
Domain Number 1 Region: 166-457
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.41e-63
Family Ankyrin repeat 0.0000187
Further Details:      
 
Domain Number 2 Region: 2-146
Classification Level Classification E-value
Superfamily PapD-like 0.0000000000000204
Family MSP-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P20280_001
Sequence length 520
Comment pep:novel chromosome:MA1:8:25345168:25346799:-1 gene:GSMUA_Achr8G20280_001 transcript:GSMUA_Achr8T20280_001 description:"Putative Ankyrin repeat domain-containing protein 50"
Sequence
MDRLINLEPSSQVVIRIEPTQKCCGELTLRNVMYTMPVAFRLDPVNRLRYAIRPRSGIIA
PLATLLVEFTYVLPLDSPLPDSLPRCDDRFLLHSVVVPSASLKVPASISDSIPGEWFTNK
KKQVFIDSGIRIFFVGSAVLTRLVEDGLMDSVREVLERSEPEWRAVDSVDSEGRTLLHLA
IAQCRPELVQLLLEFEPDVEAADRNGRTPLEAAAAAGEALIAEILIARRASVERSRGSDL
GPLHLAAAAGHAEVVRLLLLNGVAVDAPAADGRTALRLAAEGRRHDCAKLLLKAGARVDA
RGGADGGMPLHAAAAGGDEAIVKLLLTRGHVRMLDALRLGDALATAARKGEVQAAARLVD
RGAAVNGRDQHGWTALMRAAFKGRVEAIRVLTDTGAEVEARDEDGYTALHCAAEAGYAEA
VEALLRRGADIGARTAKGATAAEIAASHGYDGIVRILARGSTALLVEKRRGGDVGAKKGK
EREGRRKKSDIGGSDGGRVAVRNGGRFHRARAAVEVAWSH
Download sequence
Identical sequences M0TS31
GSMUA_Achr8P20280_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]