SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P22620_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P22620_001
Domain Number 1 Region: 130-163
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000842
Family PHD domain 0.0067
Further Details:      
 
Domain Number 2 Region: 222-251
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000168
Family PHD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P22620_001
Sequence length 276
Comment pep:novel chromosome:MA1:8:27186265:27192909:1 gene:GSMUA_Achr8G22620_001 transcript:GSMUA_Achr8T22620_001 description:"Transcription factor"
Sequence
MAKTKPGKKDLDSYSIKGTNKVVKVGDCVLMRPAESEKPPYVARVEKIEADHRNNVRVRV
RWYYRPEESIGGRRQFHGAKELFLSDHYDVQSAHTIEGKCTVHSFKNYTKLENVGAEDYF
CRFEYKAATGGFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWQFPQIMFLIITVPLCELQ
TPQCIWTRSLFYNIRSLQEIQCIYVMMLNVIIVSNKHEFMDRFHPSCMGMTIEQAKKLDH
FLCSDCVSENDAKRSMNGFPTSPVSEAKAEPKRRKR
Download sequence
Identical sequences M0TSR5
GSMUA_Achr8P22620_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]