SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P22880_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P22880_001
Domain Number 1 Region: 470-530
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000002
Family PHD domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P22880_001
Sequence length 535
Comment pep:novel chromosome:MA1:8:27406238:27408447:1 gene:GSMUA_Achr8G22880_001 transcript:GSMUA_Achr8T22880_001 description:"Putative PHD finger protein At1g33420"
Sequence
MLIMARLCIPFEGARKRKRGEQSFGFDSFCDTGNPTHLTGSFQDKLKALLMFAHPEAVAQ
GELQCHSFQLELHRHPPTSVRLFVLEEDVETSTCRRCRYCVSVVGWGHHIICSKRFHFVL
PTKDTLSEISVIDASTKGKMELRLVHGVAYGEPWFGRWGYRFGHGSYGVTEQMYQRSVDA
LHALSLRLLLPHLACFGREIPVIVGKYQSLCNQVLLTLGDLFRFMIELKTRLPPNSMDYH
GAITEASCRWSTKRVEMAARVIVEQLKNSELRWVTRQEIRDAARAHIGDTGLLDYVLKTL
GNHIVGNYVVRRTVNPITKVLEYCLEDISNVFTGHDNLASGNHSKSRIRLQLTRTQLMRD
MFYLYKNILKEPSSAAATGMLDAIPVAVRMRTPPHETVIVPAHATIGELKREVGRHFRAV
YWGLKSFVADSIVGVRCRDSDLVHELMQSGSSIVVEGRMEGDDGEEIYEGGNGGNKIVDC
LCGGKEEDGEPMIFCDICEVWQHTRCVGIPDKDDIPPVFLCGRCENDMLALRNLA
Download sequence
Identical sequences M0TSU1
GSMUA_Achr8P22880_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]