SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P23210_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P23210_001
Domain Number 1 Region: 1026-1080
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000093
Family PHD domain 0.014
Further Details:      
 
Domain Number 2 Region: 242-294
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000509
Family PHD domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P23210_001
Sequence length 1436
Comment pep:novel chromosome:MA1:8:27731246:27747558:-1 gene:GSMUA_Achr8G23210_001 transcript:GSMUA_Achr8T23210_001 description:"PHD-finger domain containing protein, putative, expressed"
Sequence
MGRGSVDVPAEAAVPGVNLFAQARKALSVSSPFDPEESAPRVPTLPSGLASFLLRGPDSH
RKHKKSHGEAAEKPSGHGTPPTVWDVTEEFFRPVTLSDIDLLAPKLPLCPGLLDSCFTMP
VFDNGVEDDKKDSKADTCAAELSSITLSKKEEVILEQQIEEVEKVQATEELPPMEIDEIV
TSVGDAMPMQTVGDDDNLSLHWLLGSKKRLVLLAERADKKRKLLDGDAGLDRLLLLPHSH
TGVNLCDFCCSIENGVKKNKFLRCHSCKVVVHQRCYGVHEVPEGVWLCAWCKHLETAGIV
SKRDGDDLSSRPCLLCPKDGGALKTVTMDPSLSPSDGAAKFVHLFCSLWTPDVYVKDTWA
MELVMNMGGIQDKRRKLVCNVCKVKHGLCIRCSHVLQFSSYDIWSSWDVSGTCRTSFHPL
CARESNHQMEIWGKFGCTNVELRAFCSKHSTFQDMGGVKDTNNLLLAIDDKKLVPKLSSA
VLPTKKLPTLQLTPNKRDQIMMQNEIANLNSEKILQMKPDEQDALVDRLDSNSGQAGTIA
EMDTDGAVDSKNIKRSTYDVSAILRKLIDQGKINADDVASEMGISLDSLQAALIGETTSF
SPGLRLKIIKWLQSSVLTPTLQPSKVRNVSDAVLVKLLPPRRRTKSNIMILKNNKALRSS
GLASVLENGNGKIVDEIDNIQVVISEDMKGNINERICSSLLIGLSNDQKPVVMTLEDTSK
AEDSVPSDPNQGQKNDMANDIEEKVSFLHYEGNQAVDTNTTTQNTMQSGYSNYYDGEVDV
VLCTKSYLENGGSGSVFVVHPLIKKKLLHMQNSELLKNKPTDPFSNAKSLCSSCVQQGLL
CAASYTSDGAKELDQLSKAKSVGVLDLSPEDEVEGEIIYLQARLLDNAVLIKHNCEDLLL
KIVENLAHELNALNKRKWDLILVNQFLREIREAKKRGRKERKHKEAQAVLAAVTAAAAVS
SRNSSLRKDSNDETVLGTQETPIKINAATGIAGLHPPLVPQTTEAFRSTFGKLSSAKHSM
AFQMPEFLKDNALSCEICMRTETILNRVFVCSRCKVAVHLDCYRRLKSPIGSWKCELCED
MSLPSTSPKSQIDGKGTSAVVAQCGLCGGVTGALRKSADGQWVHALCAEWLLESSFRRGQ
ENLVEGMDTISKEKATCCICYHNVGACLKCSYGHCKVTFHPSCATSAGFYMNAKVTDDNI
QHKAYCGKHSIGQREADNQQCGSEDINSLKQIRVELEKLRLLCERSIKREKLKKDLVRCS
HDILASRRDCAAYSVLVRSSFQSGASSESATTSINNRSYSGTIQRSDEITVDSTVSREHT
IRCSLHNKNFDRNTDDSSSSQLSFKRKLADRASFAGKQLPQKSASNAFWKSADGENRPKA
KKTETFQKELVMTSDQASMQNQRLPKGYFYVPVGSLSKELPLEQDLESHELQEPGG
Download sequence
Identical sequences M0TSX4
GSMUA_Achr8P23210_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]