SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P23890_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P23890_001
Domain Number 1 Region: 214-277
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000509
Family PHD domain 0.0027
Further Details:      
 
Domain Number 2 Region: 485-550
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000752
Family Homeodomain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P23890_001
Sequence length 666
Comment pep:novel chromosome:MA1:8:28225509:28238682:1 gene:GSMUA_Achr8G23890_001 transcript:GSMUA_Achr8T23890_001 description:"Putative Homeobox domain containing protein, expressed"
Sequence
MKTSRKKLICYTPKKSSLLGKELHSKLDSESAKKNLRKVSYSRRCRLKPNTFMKKRGIRR
RNFLNGKPVKTMQKISHHTSVNGQCLSRLSTNGSSCLCSKGNPGTSDDNGTIKLHRRRRR
KRKKKTVERDEASCLQRRTRYLLIKIKLEQNLIDAYSGDGWNGQSREKIKPEKELLRAQK
QIVKCKIGIRDAIRKLDSLSCVGSIADSLMHPDGSVFHEHIFCAKCRSTEAFPDNDIILC
DGTCNSGFHQKCLDPPLEKIPPGDQAWLCKFCTCKFEILEAINAHLGTCFSVNSNWEDIF
KEATACSDVENTGLNHAEVWPSEDSEDEDYNPETNENSNSRSGIEENMSNDSSSSSLFSS
SDGTISYSDSEHYSYLEKPFNIISRSKNRVDLFDSVGNYDSGPSNECAITSYRRQRRDVD
YKKLHDEMFGKEPPENVAQSEDEDWGPNRRKRRKMEETTGTCMANPVNEDGSSNLALTEK
ISCDKKQLFRIPPVAVEKLRLAFAENELPSRSAKENLSKQLGISSEKVSKWFKNARYAAL
RMRKNETTNAVKNQDTSISMNESLSEDLGPPGCRVGKSFREVSGRRRLVLERTFNKGGTG
CQLDEKTDSEQLYLTEVERLCRLEDKLQSLKKTLLSCMDEDKLTTKTCVREETVIYVPVA
EVKEKA
Download sequence
Identical sequences M0TT42
GSMUA_Achr8P23890_001 XP_009413966.1.42102 XP_009413967.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]