SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P24300_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSMUA_Achr8P24300_001
Domain Number - Region: 6-71
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000306
Family Ankyrin repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P24300_001
Sequence length 87
Comment pep:novel chromosome:MA1:8:28532884:28534567:-1 gene:GSMUA_Achr8G24300_001 transcript:GSMUA_Achr8T24300_001 description:"Squamosa promoter-binding-like protein 16"
Sequence
MNLFPPNVAAPAGVAPWHLAASMQDSEDIVDALTNDPQEIGLKCWNSLVDENDQSPYMYA
VSRNNLSCNRLVFASAYLSRFTAYWFC
Download sequence
Identical sequences M0TT83
GSMUA_Achr8P24300_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]