SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P28030_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P28030_001
Domain Number 1 Region: 849-996
Classification Level Classification E-value
Superfamily SET domain 3.01e-45
Family Histone lysine methyltransferases 0.0058
Further Details:      
 
Domain Number 2 Region: 174-293
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.62e-16
Family PWWP domain 0.0045
Further Details:      
 
Domain Number 3 Region: 542-618
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000487
Family PHD domain 0.014
Further Details:      
 
Domain Number 4 Region: 380-433
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000664
Family PHD domain 0.012
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr8P28030_001
Domain Number - Region: 679-709
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00244
Family PHD domain 0.026
Further Details:      
 
Domain Number - Region: 463-530
Classification Level Classification E-value
Superfamily SAND domain-like 0.061
Family SAND domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P28030_001
Sequence length 999
Comment pep:novel chromosome:MA1:8:30948507:30963040:-1 gene:GSMUA_Achr8G28030_001 transcript:GSMUA_Achr8T28030_001 description:"Histone-lysine N-methyltransferase ATX4"
Sequence
MIIKRSQRVVMPTLKRCNAEVTVGDGEGDGGGKRRKRRREGESFPLEVLGDVAAAGGFPY
VALGFGRCLGGEDAAAAVAADARERTREAAPPEVRPPVVRTSRGRAQTLPSRYRACRNIS
LEKCSLSQSTSTSLCEGLETREERRPNPRFRYPAKKEKLQKKTLEQGKDYHRLEEFACGD
IVWARPGKNCPAWPAMVIDTMQQAVRQITDAYIPGAICVMFFGYSGSGNERQEYAWVKQG
RVFPFIDYVDRFQGQTGLHGCKPNNLRIAIEEAFLAEHGFTGVQVDGMSTSGEPAYVSGI
KEATGSNHDEECQSENKAKTENYITGSVAGFFALNKTSLNLRCTETASSTLLASTNQSFC
NPFNDPVDAHFLLQPFKSKQYRGICMKSCHHKDDEKWVRCYACRYWVHAGCDKTYKKLQS
IDYFCSECKSKFNFESSDTEKNHSQIRYVPDCGRDTKLAFDKVAVWCFGMEGIYLPEQHV
ISCHCTSCKEKKFMLTEWERHTGSKTKNWRSSIKVRSTNMALGKWLERYHSSMVSTNHTK
RPSAKLRKQKLLAFLQEAYDPVYVKWTTERCAICRWVEDWDYNKIIICNRCQIAVHQECY
GMRGKQDFTSWICRACETPQQKQECCLCPVKGGALKPTDDEMLWVHVTCAWFQPQVSFAS
HETMEPAVGILDIPSESFVKVCAICRQMHGSCTQCYKCSTYYHAMCASRAGYRMELRCLE
KNGKQITKKVSYCAHHWAPNPDTVLIIHTPQGVFSSKKMIQNNKKQTGTRLIRKGILHGS
DILVQNSETPSAARCLMYRNIEIKTKDEEAIAHRVMGPSHHSLDVVQCLNAPKEEKDLEL
FSTFRERLYHLQSTEKSRVCFGRSGIHGWGLFARRNIQEGEMVIEYRGEQVRRSVADLRE
ARYRLEGKGCYLFKISEEVVVDATDKGNIARLINHSCMPNCYARIMSVGDDESRIVLIAK
TNVSAGEELTYDYLFDPDESDECKVPCLCEAPNCRKFMN
Download sequence
Identical sequences M0TUA6
GSMUA_Achr8P28030_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]