SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P30460_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P30460_001
Domain Number 1 Region: 157-230
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.73e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P30460_001
Sequence length 471
Comment pep:novel chromosome:MA1:8:32519354:32525052:-1 gene:GSMUA_Achr8G30460_001 transcript:GSMUA_Achr8T30460_001 description:"FYVE zinc finger domain containing protein, expressed"
Sequence
MVTSEEITTYSALSKLDTANHDDRERADFLVDHHSGSLSSPRGSRQDYLCQPSSKPDFPD
NNSTQEPCFISQNGANHKGNLKNVLSGLSAMVTSRNLVDGAIQSQLNSSLDISFLSSELN
GDSFLCPSVCMPSAPPLLGVESVNYSAYKDILAAEPPEWLPDSYSKVCMQCNSPFTAITR
GRHHCRFCGGIFCRDCTKGRCLLPVKFQERNPQRVCDTCYDKLDSLQSILINSNSNAVQS
AKHDVTDWTCMRGWLNLPVGLSMEYEIYKATNTLRSYCQVARLNPEKSIPWSVLRGAKGL
AILTVVKVGALLTYKVGSGLVVSRRVDGSWSAPSAILSVGLGWGAQIGGELMDFIIVLHG
SKVVKAFSSHMHISFGAGISAAAGPVGRVFEADLRAGAKGSGICYTYSCSKGAFVGVSME
GNVVATRMDANLRFYGDPYLTTGDILFGTVERPKAAAPLYLALDELYSKVS
Download sequence
Identical sequences M0TUZ8
XP_009414832.1.42102 GSMUA_Achr8P30460_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]