SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P30680_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P30680_001
Domain Number 1 Region: 186-249
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.77e-17
Family PHD domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P30680_001
Sequence length 251
Comment pep:novel chromosome:MA1:8:32624522:32628699:-1 gene:GSMUA_Achr8G30680_001 transcript:GSMUA_Achr8T30680_001 description:"PHD finger protein At5g26210"
Sequence
MDGGSAGHYNPRTVEEVFRDFKGRRAAMIKALTTDVEDFYQQCDPEKENLCLYGFPNERW
EVNLPAEEVPPELPEPALGINFARDGMQEKDWLSLVAVHSDAWILSVAFYFGARFGFDKV
ERKRLFGMINDLPTIFEVVNGKNKVRTSETNHSNNKSKSNTKVRVSDSHPKYLKGQPKEE
DDELDEDDEEEHGDTLCGACGDNYASDEFWICCDICETWFHGKCVKITPARAEHIKQYKC
PSCSNKRPRPS
Download sequence
Identical sequences M0TV20
XP_009414808.1.42102 GSMUA_Achr8P30680_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]