SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P31340_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P31340_001
Domain Number 1 Region: 408-651
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.45e-34
Family Extended AAA-ATPase domain 0.047
Further Details:      
 
Domain Number 2 Region: 135-194
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000208
Family PHD domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P31340_001
Sequence length 800
Comment pep:novel chromosome:MA1:8:33034692:33043680:-1 gene:GSMUA_Achr8G31340_001 transcript:GSMUA_Achr8T31340_001 description:"ORC1 - Putative origin recognition complex subunit 1, expressed"
Sequence
MDATPRKPKPRSTPLRPKPSPLVPPTPESATPRRSLRLHRSASGLASPLTPGPAAGRLDI
PRSARKAKRSLQIDEAPLTEPPSAFSPVTPESKRRRRSQPSRASNGRVYYKKVVYDGGEF
EVGDDVYVKRKEAPESADDDPEVEECRICFRTGRRVMIECDDCLGGFHLVCLEPPLRKIP
EGDWICGFCQARKMGIDVELPKPPEGRKMRRTAKEKLLSSDLWAARIESLWREPDGTYWL
KCRWYIIPEETAVGRQPHNLRRELYRTNDLGDIEIESVLRHCYVMSPNNYKEASNEGDDV
FYCEYEYDIHWHNFKRLTDIDDAIENDKGVESDEDWKISKDPDTDEDSECEELARVNHSA
QRRHESAANIRKGRTFGLQKIGIKRIPEHARCSKQTDLEKAKAMLLLATLPKSLPCRTKE
MEEITAFIRGAISDDHCSGRCLYIHGVPGTGKTMSVLAAMRNLRSEVDARTVRPYTFVDI
NGLKLASPENIYKVIYEALSGYRVGWKTALHLLNERFSKGGGVSNNELRPCVLLIDELDL
LLTRNQSVLYNILDWPTKPQSKLVVIGIANTMDLPEKLLPRISSRMGIQRLCFGPYSYQQ
LQEIISSRLKGLDAFEEQAVEFASRKVAAMSGDARRALEICRRAAEIADYQFKQSPLCKQ
PSESVDGSFEGKRLVGMADIEAAIHELFQAPHIQIMKTASRLGKIFLVAMVYELYRSGLG
ETNFEKLATTVASLCTSNKEASPGWDTLLKVGCKLGESRIILCEEGTKHRLQKLQLNFPS
DDVAFALKDCSELPWLSKYL
Download sequence
Identical sequences M0TV86
GSMUA_Achr8P31340_001 XP_018685593.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]