SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P31420_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P31420_001
Domain Number 1 Region: 5-84
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000129
Family Ankyrin repeat 0.0018
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr8P31420_001
Domain Number - Region: 187-217
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00137
Family CCCH zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P31420_001
Sequence length 563
Comment pep:novel chromosome:MA1:8:33093483:33096074:-1 gene:GSMUA_Achr8G31420_001 transcript:GSMUA_Achr8T31420_001 description:"Zinc finger CCCH domain-containing protein 24"
Sequence
MLLQHRTPLMVAATYGSLDVLELLLSLPSSVDVSRADGHDRATALHCAASGGSPNAADAV
KLLLSAGADSNLVDASGHRPADVVVVPLKVPDVRTVLEELLGRSSNGTCRDHHHPPELQP
PAVVTEKKEYPVDPSLPDIKSSIYATDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENAR
RRDPRKYHYSCVPCPDFRKGTCRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTNCSRRVC
FFAHTHEELRPLYMSTGSAVPSSSAAIEMAAAMGLMPGSPSSISTVMHPFTSPLSPSGNG
IGHSSLAWAQPNVPVLHLPGINLKGSRLRTSLSAREMPLDDFSAMPEFDAQQLLNDPSHT
CLSPSMGNLMARPKILAPSNLDDLFSAEIASSPKYNSDQGAIFSPSHKAAIHSQFQQQQQ
QQQGLLSPINTPASPKSSHLALLGQQEKQQQTLRSLSSRDLGSGTSLVFGSSGNSSWSKW
ASPSGILDLGVNGEELGRLNQSSSFELQANGEEPDLSWVHSLVRESPSEEVGTASVAPAW
PSGLGPAADGLCSYVTSDRTSTL
Download sequence
Identical sequences M0TV94
GSMUA_Achr8P31420_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]