SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P31480_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P31480_001
Domain Number 1 Region: 190-251
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000146
Family PHD domain 0.0058
Further Details:      
 
Domain Number 2 Region: 281-339
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000169
Family PHD domain 0.0051
Further Details:      
 
Domain Number 3 Region: 143-199
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000206
Family PHD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P31480_001
Sequence length 830
Comment pep:novel chromosome:MA1:8:33131096:33147626:-1 gene:GSMUA_Achr8G31480_001 transcript:GSMUA_Achr8T31480_001 description:"protein binding protein, putative, expressed"
Sequence
MAFHIACPITCRRICDCELGFPAALRGEAARSGFLDEIDALEEFLRDPWTVRPADEEVEE
TVQVWVPRVAQVAAPPSAAVDDGGGGGGGGAGDEVKRALLQRQALAASLAAEDYVRRLEA
GNGSVSEATSNLAGEDQGIPTIKVMCRICFTGESEGSEKAMKMLSCKSCNKKYHKSCLKT
LAEHRDLFHWSSWSCPSCRICEVCRRTGDPNKLMYCKRCDGAYHCYCQQPPHKNVSRGPY
LCPKHTRCHSCGSTVPGSGLSTRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSEITPMV
CCDACERWVHCLCDGISDEKYQQFQADQNLQYVCAACRGDCYQVKDIHDAVRELWKRKDI
VDGDLIASLRVAAGLPSQEETYSISPYSGDEQSGPIILKNDNSKPLKFSLKGISDKSSKD
YGNISLNKKQAKKKGYRIKLVGKKEETYSNMERQNEARSLESSYRDQRIDEMTSSRPDGP
DVLSSSTARSPNANGMKANQLGNCEQNMVKDVARDNADTVPKVKIKSSKLQGLHFKECAG
KSPNKNDTARSTKLVIHIGSTNKNAPSSPRSETSSCHKDQELAASFGAKMDNSNTKRSPE
HGVKGKTIIKIGKFHEKHQKSNGNVTDARELNTTDISVMRRSEITAAAENASTERSDKVL
QKKQTADISVRSHRDSNEMLPSNFTSSSSKDPKTLLKLKFKNPYFEQKSSWAPNGEEENS
VKGQRSKRKRPSNEKMGGWQDERLSKLHLENLIDEAMDANWILQKLGMDAIGKRVEVQSS
DGSWHQGTVTDVNQDTSSLSVRLDNGRSILLELGKQGIRFISQKQKRAKT
Download sequence
Identical sequences M0TVA0
GSMUA_Achr8P31480_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]