SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P33940_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P33940_001
Domain Number 1 Region: 370-450
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.92e-24
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0016
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr8P33940_001
Domain Number - Region: 228-300
Classification Level Classification E-value
Superfamily PH domain-like 0.0004
Family Third domain of FERM 0.055
Further Details:      
 
Domain Number - Region: 161-214
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0377
Family Viral proteases 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P33940_001
Sequence length 521
Comment pep:novel chromosome:MA1:8:34845969:34853248:-1 gene:GSMUA_Achr8G33940_001 transcript:GSMUA_Achr8T33940_001 description:"zinc finger family protein, putative, expressed"
Sequence
MQHGGDYGSYYAPQYPPPVSNPNPNPNPNPNPVEFPPSNPIQQPYASAPPYSTDFPAYSS
AAPTPAPAPYAPYSQKPEPAPPLPPSAPSYSQPQSQFPPQFPTFPTYSPSAARPDQEAQY
LNDNPGMYGHGRSGFGQDFREKNPYGGMRYDEFVPQNDGLGDGVYQYDGGRSEPYGARGT
VPTRSPALFDDYGRSISFPSGGKDQGGSSGKIVRAVPKVETQQDVKHGVQKFRVKLLPEG
GGQSTMDVLCQIGLDGIRMLDPSTNRTLRIYPLETVTKWEVSESSTFTFWSKSSVDFDPR
RIRLQSNSYTTNTILDTVTAATFKEMGGKDSLISGRGTVDASKLSDQSTERKKGLVDWMT
LIKPANEEKDHWVPDEAVSKCTSCGSDFGAFNRRHHCRNCGDIFCDKCTKGRIALTADEI
AQPVRVCDRCMAEVTRRLSNAKEAASKPAGLQTHEDLARKLQEEMDKNLKSVSKSTKVSG
KGMREVACPICTVHLQVQVPASGSETIECGVCQHPFLVSAR
Download sequence
Identical sequences M0TVZ6
GSMUA_Achr8P33940_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]