SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr9P01280_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSMUA_Achr9P01280_001
Domain Number - Region: 12-79
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00345
Family PHD domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr9P01280_001
Sequence length 101
Comment pep:novel chromosome:MA1:9:982765:983241:-1 gene:GSMUA_Achr9G01280_001 transcript:GSMUA_Achr9T01280_001 description:"Uncharacterized protein At1g07170/At2g30000"
Sequence
MCRKQPGIAIGRLCEKDDGKCVICDSYVRPCTLVRICDECNYGSFQGRCVICGGVGISDA
YYCKECTQQEKDRDGCPKIVNLGSAKTDLFYERKKYGFKKR
Download sequence
Identical sequences M0TWI5
GSMUA_Achr9P01280_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]