SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr9P01330_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr9P01330_001
Domain Number 1 Region: 495-578
Classification Level Classification E-value
Superfamily E set domains 9.1e-17
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 697-787
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000138
Family Ankyrin repeat 0.002
Further Details:      
 
Domain Number 3 Region: 850-957
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000104
Family Motor proteins 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr9P01330_001
Sequence length 1060
Comment pep:novel chromosome:MA1:9:1001083:1020126:-1 gene:GSMUA_Achr9G01330_001 transcript:GSMUA_Achr9T01330_001 description:"Calmodulin-binding transcription activator 4"
Sequence
MQHGFDINVLCQEAQKRWLKPSEVFFILQNYKQFPLTPEPPHLPPSGSLFLFNRKVLRFF
RKDGYMWRKKKDGRTIGEAHERLKVGNVDALSCYYAHGEQNPYFQRRIFWMLDPAYGHIV
LVHYREVAEGRYVSGSISNFSTESCSNLNQTTSIINADKGINSGTTELNEPYYSPGSTEE
VSSKFVLENFEANRNNLLDRLENPDKKPQPEVNQALRNLAAQLSLDDDDDDDSIYFREVL
PAYSTQNESTLGLGHLHYEQTEFSQAHENLLQGLELRGHGEINEAEKQQSYATTQLPKVL
GDHGAKQSEPLYLESPSWTDVLTSSSSSAGVNRHGRNSNFLALNGILDSSIPKDTLRPFL
DREKISANSFVPSENLDCYKAVDQSNGHEILESDLHLQLSATRRFLLGSENSIESPSSVS
HLKASDIHHTSGEITYEASSRKENSTDWMGTIPVTPGNTTYTSEFSSMLFDNNHFGASLG
TDSSLTVAQKQRFSIREISPEWAFSYESTKVIITGDFLCNPLESPWAVMFGDIEVPSEIV
QEGVLRCQTPQHSSGKVTLCVTSGNRESCSEVREFEFRTKPTTSSSGDICTTDAAKNSEE
LLLLARLVQMMLCGYDGSTIAKGAIETQLENSRKVNTTDERWQQIIEALQMGCDISLDTR
DWIMQELLKDKLQNWLSLRRQSNEQTGCLLSKQEQGIIHLISGLGYEWGLGPILDFGVGI
NFRDSNGWTALHWAAHYGREKMVAALLAAGASAGLVTDPTTQDPLGKTPGFLASATGQKG
LAGYLSEVALTSHLSSLVIEESEISKGSAEVEAERAVESISQRSVEIRGGTEDELSLKDS
LAAVRNAAQAAARIQAAFRAHSFRKRQLKSAWSCDDYGMTPGDIQELSAASKGHRLYHGS
HDHNFDKAALSIQKKYRGWKGRKDFLTLRQHVVKIQAHVRGHQVRKKYREFVWTVSVIEK
VILRWRRKGVGLRGFRAEPEMVRDEEEEDITKIFRKQKVDAAVDEAVSRVLSMVESPDAR
QQYRRMLGRYHEAKAEFSNSDEATSRLRDDLEAIDNDFIY
Download sequence
Identical sequences M0TWJ0
GSMUA_Achr9P01330_001 XP_009415886.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]