SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr9P02480_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr9P02480_001
Domain Number 1 Region: 165-423
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.94e-52
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 37-133
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.26e-21
Family Ankyrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr9P02480_001
Sequence length 444
Comment pep:novel chromosome:MA1:9:1770208:1779700:-1 gene:GSMUA_Achr9G02480_001 transcript:GSMUA_Achr9T02480_001 description:"non-receptor tyrosine kinase spore lysis A, putative, expressed"
Sequence
MDVVAKLKRGVSRQLSLGSLPVRGELGLPENLDATMRLMFMACQGDARGVEDLLKDGLDV
NNIDLDGRTALHIAACEGHVDVVRLLLSWRANIDARDRWGSTASADAKYYGNDEVYGLLK
ARGAKTPKTRKTPMTVYNPQEVPEYELNPAELHFRRAKLEPGLSSGTCQVAKWNGTKVSV
KMLDQDAYSDPVAINSFKNELTLMQKTRHPNVVQFIGAVTQNLPMMIVSEHLPKGDLGSY
LKNKGRLRMNKALRFALDIARHVFKLLLGINYLHECKPDPIIHCHLRPKNVLLDDGGQLK
VAGFGSIKMLKISPDRYKLVNPMADTNSSYIAPELYKNEIFDKSVDSFSFGLILYEMIEG
IPAFRTHIKAPGDVAKMICLEGSRPILKTRSKNYPADLNELIEECWDPQPMVRPTFSEII
LRLDKMYANCPKNRWKDNFRLPWR
Download sequence
Identical sequences M0TWV5
GSMUA_Achr9P02480_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]