SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr9P04380_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr9P04380_001
Domain Number 1 Region: 1-54
Classification Level Classification E-value
Superfamily SAP domain 3.97e-16
Family SAP domain 0.0057
Further Details:      
 
Domain Number 2 Region: 112-172
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000332
Family PHD domain 0.0003
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr9P04380_001
Domain Number - Region: 372-410
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0314
Family PHD domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr9P04380_001
Sequence length 870
Comment pep:novel chromosome:MA1:9:2911603:2927856:1 gene:GSMUA_Achr9G04380_001 transcript:GSMUA_Achr9T04380_001 description:"E3 SUMO-protein ligase SIZ1"
Sequence
MDLVTSCRDKLAYFRIKELKDVLTQLGLAKQGKKQDLVNRILQLLSDEQVPKSQVWGKKN
PFWKDEVAKIIDDTYRKMQVSGATDLASKSTSTTDFNQVKPKEEIDDYCLEMKVRCLCGS
SLTSDSIIQCEDPRCRVWQHIGCVIMPEGTLEGASPELPPRFYCEICRIKRADPFWITIG
HPLLPIKLTSSGVTADGTSTSQNVERTFQLSRAHRESLQRAEYDLQVWCLLLNDKVPFRM
QWPQFAELQVNGDAVRVVTRQGSQLLGINGRDDGPVVTTCSKEGINKICLSWHDARVFCL
GIRLAKRRSIQQVLGLVPKEGDGERFEDALARVCRCIGGGAATENADSDSDLEVVANSVT
ISLRCPMSGSRMRIAGRFKPCVHMGCFDLQTFVELNQRSRKWQCPICLKNYSLENIIVDP
YFNCITSLLQNCGEDVNEIDVKPDGCWRVRNENEFNDLSKWHMPDGSLCVNTCTEVKPDL
EKLKQIKQEDTSEVHRSLKLKRNRKGLWEFSKPDSTSLQSSQNHDFNKLEGHCQIMPMSS
SASGSYRDVEDLIVNQEAAGCSGLSLNRRHEPSSPGLNIESTYAVGNTFHSSPRNSPDVI
VLSDSDEDNPSLISPETTYDTRAIVDSEIPFPSPPRGSEGFPESTALGMRTSGSILLDNN
TDDFAMPLWHIHASPQAGPGFQLFGANAEVQDPLVDSDNSLGCVLTDVYGLASNVGLGDT
SRMQNRSTCHSSTELHESLVDNPLPFCSDDPSLQIFLPSQPTGIPLQDDLDDRPEVPNGV
TSDDWISLTLAGGDGGSAPSTRPRSGQQHTPKESRMEPLDGAASLLLSMNDNRADKVNSK
NKRSDHPFSHPRQRRSARPRLHLSINTDSD
Download sequence
Identical sequences M0TXE7
XP_009416280.1.42102 GSMUA_Achr9P04380_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]