SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr9P11210_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr9P11210_001
Domain Number 1 Region: 662-721,786-949
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.49e-55
Family Tandem AAA-ATPase domain 0.0005
Further Details:      
 
Domain Number 2 Region: 565-753
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.77e-44
Family Tandem AAA-ATPase domain 0.0000895
Further Details:      
 
Domain Number 3 Region: 62-119
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000135
Family PHD domain 0.0016
Further Details:      
 
Domain Number 4 Region: 515-558
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000255
Family Chromo domain 0.0064
Further Details:      
 
Domain Number 5 Region: 1512-1564
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000453
Family DNA-binding domain of telomeric protein 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr9P11210_001
Sequence length 2058
Comment pep:novel chromosome:MA1:9:7289358:7303412:-1 gene:GSMUA_Achr9G11210_001 transcript:GSMUA_Achr9T11210_001 description:"CHR4/MI-2-LIKE, putative, expressed"
Sequence
MREESSLCDDMIDRNWVLKRKRKRITSGVNLLNGKEGTSLSSESLLKSTSVKRKLKGDID
KIKGHDGHYFECAVCDLGGNLLCCDSCPQTYHLECLTPPLKCTPPGKWHCPSCSDHKDNV
KTPSNAEAYLRRARTKTMFEKSTIVHKQTINDKASLSERNFIPENNKGKTTFSPESKIKK
KSEFSFHWKTSSRKEAHSLVKSLKSDHSKNFPEESSDKYKRDVQRKKLIVPFALPTQKAR
KKKQKLSRRDKKKRSRTEKGKDVATAVSNELSTENCFETSGSPKKCESFDQWISASKKED
KTLKYDSEEQYEVCSKAFLRSSLTNSSFGNIHTFDHGKLETIILVIQLQSLLSLIHVDRI
LGCRVQPNTTMSSQTIRSATHQEYANSEINSGCLAIGQASYGIIDPQNSSKLLVQCQNGS
KVETKDTESALKDGFDGEANLVSEEKNVCHKAAVCEAHNGQCETKGFSENAVSATECSQD
GFITKKKNNVESRTTEEMIQDSETKNNNVVYEFLVKWEQWKKPLRVIALRACKDGLKEAL
VKWCGLPYDECTWERLDESIINESAHLLEALNWLRKCWRKSKNVILADEMGLGKTISACA
FISSLYSEFKAKLPCLVLVPLSTMPNWMADKSDKSTKLYKFNVLLTTYEMVLADTSHLRG
VPWEVLIVDEGHRLKNSSSKLFGLLNTFSFQHRVLLTGTPLQNNIGEMYNLLNFLQPVSF
PSLSAFEEKFDDLTTAEKVEELKKLVAPHMLRRLKKDAMQNIPPKTERMVPVELTSIQAE
YYLEFLHEMRIKASAKLTLLHSMLKILYKEGHRVLIFSQMTKLLDILEDYLAIEFGPKTF
ERVDGSVSVANRQAAIARFNQDKSRFVFLLSTRSCGLGINLATADTVIIYDSDFNPHADI
QAMNRAHRIGQSKRLLVYRLVVRASVEERILQLAKKKLMLDQLFVNKSGSQKEVEDILRW
GTEELFNDSEGVNGQDLKEASTSKLDAGCTKILWDENAIQKLLDRSDLQSVPENTDVDLE
NDMLGTVKSVDWNDDTNEEPDGTDLLSGIAGDGSEQKSEAKEDNAAGGTEENEWDRLLRV
RWEKYQLEEEAALGRGKRLRKAVSYKETFASIPSETFSESGNEEEEPEHEYTPAGRALKE
KFARLRARQKERIAQRQTAELSNMIDKTELPNESLVQSVNEMEGLAKKNHDNKNDQVVAI
NLEDNRPSQQLDGNRSESFARFGKFSKHGYKRFHSDHLDLSVRPPENLSPDIFLPSHQLQ
SANIASSMPSSSLLPVLGLYAPNANQVGLSSRNFRAPLRQPISSSEQRQINRGNVEYLFP
SASSSRPSSDPSVEVREKSASTSTLPEASGYSLNHKLKNMIPDSYFPFCTPAPTSGRPPL
DALENSGSSFASFQEKLGLPNLILDDKLVPKFPLPSKSLMKQHVDLLPSLSLGMEFVNDT
FQEFPDMPVLPNFKQQPSDSLKQKQQMTELPSMHGLGHVQGTYSSLPENHQMVLDNIMMR
SQSATNKLFKKRLKVDAWSEDELDSLWIGVRRHGRGNWDAMLRDPILKFSKYRTAEDLSL
RWKEEQQKIMDVPAFSAPKSSKSLSFPGISDGMMTRALLGSKFSGLGSERPKSLSHLTDI
HLGCGDFKSSFPCIDPFGQVSRIDENFPQVVAWQHERLRPNYTGDLSAGAFNRLDNVSLP
FDHPCQGNLATSLSVNLQKNEDEYHAKKNHPVPVVPDKQLNLLHNSSCNVNPKESNMGIP
LIPQKKQVFPNFSSNNDIALGSSNTDKLPHWLREAVNIPSSRPSEREVPLMLPPAVSAIA
QSVRLLYGEEKTFPPFAIPGPLPIQPKDPRKSLKRKKKLNKLRQLTPDIGCATKNFDHGA
SSSIPPAPEIMEFVPDPGKSDLSENLTQNLNLNSPSSSLFVTQGKSSVSALAPSPEVLPL
VTSCMPSGPSELLITDMPGPSCQVAEISESNDLVFKQDKEVLNGDKKDIHGKQKIHENSL
LGCWDTMLSSEKIDQVDDGDLSKTHSDTSKSNQVKVEEMSSEETILSSTLTPTSAWVHRS
MPATPSPASPPAHPSLPR
Download sequence
Identical sequences M0TZD0
GSMUA_Achr9P11210_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]