SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr9P14260_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr9P14260_001
Domain Number 1 Region: 1308-1582
Classification Level Classification E-value
Superfamily SAICAR synthase-like 9.15e-78
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00034
Further Details:      
 
Domain Number 2 Region: 409-581
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.65e-43
Family Group II chaperonin (CCT, TRIC), apical domain 0.00032
Further Details:      
 
Domain Number 3 Region: 32-105
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.21e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.002
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr9P14260_001
Domain Number - Region: 364-415,574-601
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.000153
Family GroEL-like chaperone, intermediate domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr9P14260_001
Sequence length 1588
Comment pep:novel chromosome:MA1:9:9245941:9257156:1 gene:GSMUA_Achr9G14260_001 transcript:GSMUA_Achr9T14260_001 description:"1-phosphatidylinositol-4-phosphate 5-kinase/ zinc ion binding protein, putative, expressed"
Sequence
METPDERFPDLVSIVKSWIPWRADPACISRAFWMPDDSCMVCYECDSQFTILNRRHHCRK
CGRVFCAKCTSNFVPANFYDIENFRGELIRVCSFCFKQSEDVAASRDEVQPSGPILSPSL
STTSLASTKSSGTANSSTSSAVSFTYSSGAYQQAPHGPVCCPSQSIQLEIYSDKQDMLIS
ETTMNSLVDKGDHSPAHFRFLNRSDDDDDDYGACHWDSEEQKFHNSDEFYGPAGFDESEQ
SYRSNKIHPAEVTIGTQDIGLPLTHSCEFHSSLGVDQGEEQGFFNNVECGSSSIYGVDST
DAEPMDFENNQQLWLPPEPEDEEDEREAEHKRAMKSVVDGHFRALVSQLLQVENISICEE
DGKENWLDIITSLSWEAATLLKPDTSSGGGMDPGLYVKVKCLACGHLSDSMVVKGVVCKK
NVAHRRMLSKIEKPRFLILGGALEYQRVTNLLSSIDTLLQQEMDHLKMAIAKIDAHHPNV
LLVEKSVSRFAQDYLLAKNISLVLNIKRPLLERIARCTGAQIVPSIDHLSSPKLGHCDLF
HVEKFLEEHGTAGQEGKKLLKTLMFFEGCPKPLGCTILLKGSNGDELKKVKHVIQYGVFA
AYHLALETSFLADEGASLPELPLKSPITVALPDKPSTINRSISTVPGFTISTAENPQPSN
AAQISSKSDSSKELGNFGKSGLVASPFCSENHTSHAFKFLSTSVTASVDTHDLPVDKNNQ
IKRTDEQQKTFVSGKNMACDMQTEDTKMIEMQHGFSGLGTSDQHNSRNDHMFPKEEFPPS
PSDHQSILVSLSCHCVWKGTVCERAHLFRIKYYGSFDKPLGRYLRDHLFDQSYRCRSCEM
PSEAHIYRYTHHQGSLTISVRKLQEFLLPGERDGKIWMWHRCLRCPRVNGLPPATRRVVM
SDAAWGLSFGKFLELSFSNHAAASRVASCGHSLHRDCLRFYGYGEMVACFKYASINVHSV
YLPPPKLEFNFQHQKWVQEEANKVVKTANDLFIAVRKSLRQVEEKVLNTGSHDGNMEVLE
SRRRLIELEGILQKEQAEFEESKQTVMKKDAKMGQPFIDILDVNRLQKQLLLQSYVWDKR
LKFAAGSFIAEPLNGSGTRNEHDQYKQSTTNQQRLDLEQDKNTKLLSTSTSVSDQFDPPE
CGLDVRRVLSDGQFPVMADLSDTLDAKWRGENGSALVDGSKLKSLTSVEEAPANSSSENL
EESICTDMMPARSGESAKAISILTKTSFSDLYAFLNKNCDSALSEYHPEYISLFKELMQQ
GWARLLLPLGVNDTVIPVYDDEPTSAISYALVCPDYHFQITDEFEKSKDVDDSTSSTSVR
YSVTCYYAKYFDALRRTCCPSELDFIRSLSRCKKWGAQGGKSNVFFAKSLDDRFIIKQVT
KTELESFIKFAPEYFKYLLESKSTSSPTCLAKILGIYQVAVKNLKGGKESRMDVLVMENL
LFGRSVKWLYDLKGSSRSRYNADISGNNKVLLDQNLIEAMRTSPIFVGNKAKRLLERAVW
NDTAFLASIDVMDYSLLVGVDENKRELVVGIIDFMRQYTWDKHLETWVKASGIFGGPKDA
PPTVISPDQYKKRFRKAMSAYFLVVPDQ
Download sequence
Identical sequences M0U084
GSMUA_Achr9P14260_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]