SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr9P15410_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr9P15410_001
Domain Number 1 Region: 256-306
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000031
Family PHD domain 0.011
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr9P15410_001
Domain Number - Region: 548-612
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00225
Family NE1354 0.061
Further Details:      
 
Domain Number - Region: 385-436
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0126
Family PHD domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr9P15410_001
Sequence length 783
Comment pep:novel chromosome:MA1:9:10116574:10126967:1 gene:GSMUA_Achr9G15410_001 transcript:GSMUA_Achr9T15410_001 description:"PHD-finger domain containing protein, putative, expressed"
Sequence
MVGRVADGRPDAEEDPSPAAAPSEAGLPGVDLLAQARKALSFRCPFDAEESTPRVPTLPS
GLASFLLRASEGHRKHKKSQGETSEKPLGNRKPSTVWDETEEFFRPVTLDDIDMLVPKLP
SGPGLLDSCLAMQVTGIGTGDGQKYDNLVADAVELSSISLPKKEEVVSTQQVKDTENVQA
AEEAQQMEVDKVVTVGGDTLSIHGGDDDHSSLHWILGSKERFVLTSERPNKKRKLLGGDA
GLDRILLLPNSLSGASLCDFCCSPETRAESNKLLRCHSCNVLVHQKCYGVHEVPEGVWLC
AWCKHLETTGEILERDGQEPGLRPCLLCPKEGGALKMVKGDSSLNTSGTTTKFMHLFCSL
WTPEVHVVDTGSMELAMNMGGIEDRRRRLVCNVCKVKHGVCIRCSHGTCRTSFHPLCARE
SKHQMEIWGKFGCDNVELRVFCSKHYTIQGMDSVKDPKNMLAVGDHSLEAEPSSAVLAAK
RLPKLRFTRKSRDKSMVQNEITNLNSEKLVQMDTDVEQNAVAGRIASEGNQAGSDAEMDS
GGVIDSGNNRTPVDVAAVLRKLIDRGKISADEVAAEMGISLDSLQAALVGETTSFSPGLR
LKIIKWLQSSIHMSALQQSRVRMLDAVLIKSLPPRRRTKSNIRILKNNKALHSSGVASVL
ENGNRKIVDETDDMPVVISEDVKGDINGRKCSNLVESLSNEQNLPEMIIEDMFKIEDSIF
PLDPNGGQKSMLFLSFILSPYVFPLFLLPLYKSIFISLSLLFMLWPVEIWTITRLAILWV
SQW
Download sequence
Identical sequences M0U0J9
GSMUA_Achr9P15410_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]