SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr9P15420_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr9P15420_001
Domain Number 1 Region: 327-380
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000968
Family PHD domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr9P15420_001
Sequence length 738
Comment pep:novel chromosome:MA1:9:10134060:10140801:1 gene:GSMUA_Achr9G15420_001 transcript:GSMUA_Achr9T15420_001 description:"PHD-finger domain containing protein, putative, expressed"
Sequence
MPRADANPWVVSGRSCYIRSPSNVGHSDLSDAEYKVDDAVEKVSSLDCKSNQADANTTIP
YGSQRDCSKNFDSDNVLLSSKFDLENDGFCSISNIHPLIKKKLLHMQNSVFFKNNPRVPF
FNDSANILCPSCTQQRLSCSCTGTNHSLDMTNLDQLSKAKRMGILGLSPEDEVEGEIIYL
QARLLDNDVVVKHSYEDLLLKIVQNLSHELNASNKHKWDLILVNQFLREVREAKKRGRKE
RRHKEAQAVLAAAAAAAAASSRNSSLRKDSNDEIISATQESSIKVNAATGRAGFSTASVP
RAREALRSSVAKLSSDKHSLAFQMPDLLKDNALSCEICMRTETILNRIFVCSSCKVAVHL
DCYRRLRNPIASWKCELCEDMSLPSTSPKSQTDGKDRSAAIAQCGLCGGATGAFRKSADG
QWVHALCAEWLLESKFRRGQENLVEGMDTILKEKDTCGICYFNFGACLKCSYGHCQYAFH
PSCARAAGFYMNAKATGASLQHKAYCGKHSIEQREADNQQCGAEDLKSLKQIRVELEKLR
LLCERIIKREKLKKELVLCSHDILASRRDCVAYSVLVRSSFFPTGTSSESATTSINNRSY
SGTVQRSDEITVDSTVSGKNKIRFSLNNRDFDRNTDDSSTSQLSYKWKLANRESFAGKQL
PRRSTSIASRRSAEDGEKNAKARKTETFQKELVMTSDQASMQNQRLPKGFFYVPVGSLSK
EKPITQDLESCEPRELGG
Download sequence
Identical sequences M0U0K0
GSMUA_Achr9P15420_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]