SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr9P15840_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr9P15840_001
Domain Number 1 Region: 564-741
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.36e-45
Family Ankyrin repeat 0.00024
Further Details:      
 
Domain Number 2 Region: 340-530
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.54e-42
Family cAMP-binding domain 0.00052
Further Details:      
 
Domain Number 3 Region: 85-337
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.58e-37
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr9P15840_001
Sequence length 845
Comment pep:novel chromosome:MA1:9:10529313:10540395:-1 gene:GSMUA_Achr9G15840_001 transcript:GSMUA_Achr9T15840_001 description:"Potassium channel SKOR"
Sequence
MAADTARVRWRRAMTLAIAPREADDAAATDDEIEYEMELEERMGSSHAASRFPLLRSCLG
LGLLGLGLSRNASGGETLLKGFLIHPDNRWYQLWTQFILLWAVYSSFFTPMEFAFFRGLP
KKLFLLDIAGQFAFFIDIFVQFRVAYRDSHTYRIVQSPTDIAFRYVKSRFVFDLLGCFPW
DYIHKAFGNKEIIRYLLWIRLTRACRVTDFFQKMEKDIRINYLFTRIVKLLVVELYCTHT
AACIFYYLATTLPESMEGYTWIGSLQLGDFNYSHFREIDLWRRYVTSLYFAIVTMATVGY
GDVHAVNPREMVFIMIYVSFDMILGAYLLGNMTALIVKGSKTERYRDKMKDLIKYMNKNR
LGKDIRDQIKRHVRLQYENIYNEASVLQDIPASIRAKIFQALYKPYIEKLPLFKGCSAEF
KNQIVIRLQEESFLPGEVILEQGNTVDQLYFVLHGVLDGIKLVENGLEEAILQLGSDSSF
GELATLCNIPQPYTVRVREFCTVLRIDKQLFTNILEIYFVDARTILNNLLEGNESNSHIK
QLESDITFHIGKQEAEHALRVNNVAYGGDLNYLKGLISAGADPKKTDYDGRSPLHLAASR
GHEDITCFLLQEGVDVNLSDKFGSTPLLEAVKQGHDRVASLLFSKGARLNIGEPGCHLCT
AVARGDSDFIRRVLKYGIDPNSKDYDQRTPLHIAAAEGLYSIAKMLIEAGASVFAIDRWG
TTPLDEAVKSGNRSMMVLLENAKSDELSMVPECAQEIKDKTQPRRRCTVFPFHPWDPEEK
RREGVVLWIPHTVEELIKSSNELLNCSGSRILSEDGGSISDAAMISDNQKLYLVADHNTT
DMNNT
Download sequence
Identical sequences M0U0P1
GSMUA_Achr9P15840_001 XP_009417677.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]