SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr9P16740_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSMUA_Achr9P16740_001
Domain Number - Region: 72-104
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0104
Family PHD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr9P16740_001
Sequence length 308
Comment pep:novel chromosome:MA1:9:11373404:11375000:1 gene:GSMUA_Achr9G16740_001 transcript:GSMUA_Achr9T16740_001 description:"Hypothetical protein"
Sequence
MTTTTTSAAAKGCGGDGCNALHPWPLHHVRHRGGIRRLCTSCVLKCHNGSFCSSCFSVLD
AGPSRPTPTPRPAVVRCSKCPSVCHLTCLQNPNLASQYLCPCCSNPDGFSYFLVSTSADA
GGVPIEGSVAPCEEKRKTIDLNSAKVLFAAARLAVASMSRAATAARVEAERKVKEAMVAR
KRAREMLERALLISKKERERIKELIGSGDKAMVASLEVINPKKKKKKAPKPEGPSVMSIT
AAHKRVQAHGIAENRKSKSTSVSSVQSSVAVDKKNTAVRTVRNQSNYVEQEENKALRFGS
KSGSVKED
Download sequence
Identical sequences M0U0Y1
XP_009417771.1.42102 XP_009417772.1.42102 XP_018686837.1.42102 GSMUA_Achr9P16740_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]