SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr9P18260_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr9P18260_001
Domain Number 1 Region: 105-125,174-324
Classification Level Classification E-value
Superfamily Ankyrin repeat 6e-42
Family Ankyrin repeat 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr9P18260_001
Sequence length 345
Comment pep:novel chromosome:MA1:9:12801489:12805578:1 gene:GSMUA_Achr9G18260_001 transcript:GSMUA_Achr9T18260_001 description:"Aberrant large forked product, putative"
Sequence
MVAGAGLSSSSFHLLHLRPSSAFRSLNPLLPPKPPLIPSSSSRAAVRAHSFAGNFEWHGS
AARAKRGSDGFWEDPDDGYDSELEEVDQELEDEEGEEVSGDQGDATISTVSQYDDLDIFQ
LLLDVIKFLCYVDSTICLFSNYKFVCIDSLAEVDLILEPEEKVFLQRNEVPDLSKISTMK
WNPFHSLALSGQIPFMDKLLEDGSTDIDCLDKDGFTALHKAIIGKKEAVISHLLRRGANP
QVKDPDGATPLHYAVQVGAMQTVKLLIKYKVDVNVADNDGWTPLHVAIQTRSRDIAKVLL
VNGADKTRRNKDGKTPLDLSLCFGKDFKSYELAKLLKLVPANRNF
Download sequence
Identical sequences M0U1D3
GSMUA_Achr9P18260_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]