SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr9P20540_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr9P20540_001
Domain Number 1 Region: 230-287
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.66e-18
Family PHD domain 0.0013
Further Details:      
 
Domain Number 2 Region: 7-34
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000336
Family PHD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr9P20540_001
Sequence length 384
Comment pep:novel chromosome:MA1:9:24579537:24587166:1 gene:GSMUA_Achr9G20540_001 transcript:GSMUA_Achr9T20540_001 description:"PHD-finger domain containing protein, putative, expressed"
Sequence
MPATGSMFHYSCVGPPLANAGMTSEYSCPFCLCVESGSLPRNGNQTLISRGIRPEIKSFC
ELLSAAKDFHARFKELNLVEEIVKQALECKFNLTEIVHHTTSYHGNDLSSISESFLNALK
AIAVAGIYDHEDCCNLELALSKNSWKVRVKKLLRGSKKPVLQQIQRLIKEGIAMGIASED
HFMREIAEVRQISLRWADVAKKVISDSGDLALSEVYKLISEGENLPLNLEKELKSLRARS
LLYCICRKPYDQRAMIACDQCDEWYHFDCIDLHEPPQKTFYCPACRPSLEEFISLPQAMR
NEERSSNVGGPDTPPVCQRESKRRGSISFGSNLHQKLQDAVDLLEVLRFSDIDQLWRENK
RPLHRTAKRRSKLGGVYVILAFNF
Download sequence
Identical sequences M0U213
GSMUA_Achr9P20540_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]