SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr9P24580_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSMUA_Achr9P24580_001
Domain Number - Region: 107-154
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00245
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.034
Further Details:      
 
Domain Number - Region: 2-24
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.032
Family B-box zinc-binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr9P24580_001
Sequence length 287
Comment pep:novel chromosome:MA1:9:29330867:29336168:-1 gene:GSMUA_Achr9G24580_001 transcript:GSMUA_Achr9T24580_001 description:"Putative expressed protein"
Sequence
MVRCLSCRKRFFCSRCIKKQYSEMSEVEVKIACPVCRGCCDCKTCSHIGAKDGGCKELAH
DHKKFNEIEHAYNLISHLLPLLKQIYQKQLNELEFEVPDQGRRFSGIQLQVNQAQNELVK
CNCCRTSLVDFHRSCSKCSYRLCLSCCRKIPKGSFPQTTSTDAFKYGESNKAHKRVAKEL
NGMKRILSTGMRPDNSYLSMVPESKENSESSILCPPKEFGGCGDGLLNLVFTVPFNWSND
LGRSAEEVAFSNFGSHSLHAYPHRTSSVPENQKIGQFSISLQEAMDR
Download sequence
Identical sequences M0U365
GSMUA_Achr9P24580_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]