SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr9P30190_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr9P30190_001
Domain Number 1 Region: 101-169
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000244
Family Ankyrin repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr9P30190_001
Sequence length 179
Comment pep:novel chromosome:MA1:9:33562128:33562733:-1 gene:GSMUA_Achr9G30190_001 transcript:GSMUA_Achr9T30190_001 description:"expressed protein"
Sequence
MASIPCSIYLYPSSSLGTTNSSSSSSTALRSVERPRSPFLAIRRSLGWLMASRLRAKVGP
CDAGSGTATGVDAEGAGIYGSQSRDDFSRYDVEQYFEHMGMLAAEGSHDKMEALLDQKIH
PVDILLMAAASEGDKPKMEELLRAGAKYDVRDGEGRIALERAASDEIKQLILQLSVRRL
Download sequence
Identical sequences M0U4S6
XP_018673760.1.42102 GSMUA_Achr9P30190_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]