SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_AchrUn_randomP00940_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_AchrUn_randomP00940_001
Domain Number 1 Region: 455-552
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.02e-16
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 260-344
Classification Level Classification E-value
Superfamily E set domains 0.000000000000308
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0048
Further Details:      
 
Weak hits

Sequence:  GSMUA_AchrUn_randomP00940_001
Domain Number - Region: 591-694
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000146
Family Motor proteins 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_AchrUn_randomP00940_001
Sequence length 790
Comment pep:novel chromosome:MA1:chrUn_random:3383244:3396603:-1 gene:GSMUA_AchrUn_randomG00940_001 transcript:GSMUA_AchrUn_randomT00940_001 description:"Putative Calmodulin-binding transcription activator 4"
Sequence
MIFVWSVFDTLANLVYFLVMLLMNFMLIHCLNMHTHCQIGNYEAINCYYAHGEPNSCFQR
RSYWMLDPAFDHIVLVHYRDVIKGRHIPKSIVSSSIDSCPTLRYSTSVSNDQAQGIHSCT
IEFNDPCQNSCSPGSVEEIISQVTGGNIKIQALRKLEEQLSLDKDKDSFASSEEELPPFC
NLNVETHNTQDETRSPKEEALQNPLDKFQQMSNGTGETAPSAEISEFSSLFTDMWFDQSQ
FGAPRRTESGLTLAERHLFTIREVVPEWAFSSEPTKVIITGDFHCSPFEHTWTVLFGDIE
VPLEIVQDGVFRCLTPQQSARKVKLCITSGNSQPCSEPHEFEFREKPEKASCSSTSVGAV
ATKISAELLSLVKFMQILFSSASNPQEDLELEVDPLRKLEGSKNQLEPIIEALLSGSMAP
EKIMNAILQELLKDKLHQWLSFKHQGATEKDHLLSKQEQCIIHMISALGYQWALLPILKS
GVCINYRDSNGWTALHWAASSGREEMVAALLAAGASAGVVTNPSAHDPAGKTPASLAAAS
GHKGLAGYLSEAALTSHLFSLTTERNERFEESAYVEDQLSLKDSLAAVRNAVQAAARIQA
AFRAYSFRRKQQEAAICMSPAGVHELSVASRSHKAFYGFSDKKYEQAALSIQRNYQRWKR
RKEFLQKRRCIVKIQAHVRGRLARENYKELLWSVGVLEKALLRWHRRGVGLRGFQAEPEY
IDEEEDDIVKVLRRQNLDTAINEAVFKVTSVVGSPRARQQYRRMLESYQQVKDSIILSSP
KGPDSASTKS
Download sequence
Identical sequences M0U5A6
GSMUA_AchrUn_randomP00940_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]