SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_AchrUn_randomP01190_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_AchrUn_randomP01190_001
Domain Number 1 Region: 212-333
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.07e-31
Family Ankyrin repeat 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_AchrUn_randomP01190_001
Sequence length 339
Comment pep:novel chromosome:MA1:chrUn_random:3927229:3937120:-1 gene:GSMUA_AchrUn_randomG01190_001 transcript:GSMUA_AchrUn_randomT01190_001 description:"Ankyrin repeat domain-containing protein 2"
Sequence
MASGSKDDKPSSGEKSEASSTQQQAGGLGTTSTPAAGFPANPFDFSSMQNLLNDPTIKEM
AEQIAKDPVFSQMAEQLQKSVHSVGQEGVPPLDPQQYVSTMQQVMQNPQFMNMAERLGNA
IMQDPGMSSMLDSLANPAQKEQIEERMARMKDDPSLKTILEEIESGGPSAMMKYWNDPEV
LQKLGQAMGVGPSDDGVTSTELSGPEEAEDGGYEDESIVHHTASIGDVEGLKKALDSGSD
KDEEDSEGRRALHFACGYGEVKCTQILLEAGAVVNVLDKNKNTPLHYAAGYGRKECVALL
LEYGASVTVRNLDGKTAIDVARLNNQDEVLKLFEKDAFL
Download sequence
Identical sequences M0U5D1
XP_009385507.1.42102 GSMUA_AchrUn_randomP01190_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]