SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_AchrUn_randomP01430_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_AchrUn_randomP01430_001
Domain Number 1 Region: 218-297
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000576
Family PHD domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_AchrUn_randomP01430_001
Sequence length 302
Comment pep:novel chromosome:MA1:chrUn_random:5568395:5583672:-1 gene:GSMUA_AchrUn_randomG01430_001 transcript:GSMUA_AchrUn_randomT01430_001 description:"Putative PHD finger protein At5g26210"
Sequence
MDRGLTASEEDLVEYVFHDIKARRAGILKALTADFEDFHQQCDPAKENLCLYGFPDEHWE
VNLPADEVPPEIPEPVLGINFARDGTNKKDWLSLVAIHSDAWLNALASYFGGRFQFDRTQ
STDMWILGTYLCRRRICRQHSWTCVLRPSATSLSSDRPFFLTFCCCFARKHLSVMIADLP
TLCEVVSEMNLQRVSGSKHSSNKSKSNSKLRASSEHQAKKSKSKHIKEEVEDLNGNDNND
DEDKHLCASCGGNDSVGDYFWICCDACEKWYHGKCVRVTPAKAKHIKNYCCPRCSHSKRR
IS
Download sequence
Identical sequences M0U5F5
GSMUA_AchrUn_randomP01430_001 XP_018676710.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]