SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_AchrUn_randomP01500_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_AchrUn_randomP01500_001
Domain Number 1 Region: 595-651
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000093
Family PHD domain 0.0047
Further Details:      
 
Domain Number 2 Region: 764-888
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000195
Family N-acetyl transferase, NAT 0.015
Further Details:      
 
Domain Number 3 Region: 652-714
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000699
Family PHD domain 0.023
Further Details:      
 
Weak hits

Sequence:  GSMUA_AchrUn_randomP01500_001
Domain Number - Region: 32-88
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00609
Family Tudor domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_AchrUn_randomP01500_001
Sequence length 962
Comment pep:novel chromosome:MA1:chrUn_random:5991301:6005073:-1 gene:GSMUA_AchrUn_randomG01500_001 transcript:GSMUA_AchrUn_randomT01500_001 description:"Putative uncharacterized protein Sb01g038485 (Fragment)"
Sequence
MILVSAAVEGQARKNPKNYRGLIRPLPPYYDIQIFEMRYGLCVDALVDDAWWEGVVFDHE
EGSTKRLIFFPDQGDQQMVMVDHLRLTQDWNETYGHWKPRGGWLLLQVLQAFEEEDALPV
SIREIWYDLSTMVSFREKIGLWMFGSLSVWEQLVSGLIRELLSVVISPFSHQNNKEEDTG
NRTGQTSWQSLYAEAERCPEAVAFYAFRSADRDSQVKPLKVAEKFHESKQPDSSVSGKEN
LELIVSENVPTYKHIEPEYGPQAISNYKRYIESSREKGFEKLPNVDIELMKLNVQKHLLY
MGWRFAERRRKLRFASPGGEIFHSLYTACEAYLEKEENMGKTYGSSLKGTNVSQNSWCAS
IGNKINDSKEVSLLCKNQCFSTSMDPDEFQKSDEVSNNGTENRSILVFSSPECGEGFGNS
CLEKLKKSKTGIKISSLLPLKVVGCRRLLEHYCSQKSKKRKVQDLRSKGYEAGSIFLQPE
QQLSERCQFVPVTSPTQKVVEATWSMLIENRIVLARQKVRYISKRDGHVLMEGHITHDGI
KCRCCRKLHSLTGFEAHAGSDKCKPGANTFLLDGRSLLQCHLQMVYGKDLINFPHPRLKH
VYAHSQSDSVCSVCQYGGTLMLCDHCPSAFHVGCVGLKDLPKGKWFCPSCRCGICASGAF
SSADQFTAKTMLYCDQCERKYHVGCLRRRGTNLKHCPTGNWFCSKKCSEIFLHLRNLLGK
SNPTTKEGFSWVLLRSKTETDANLNQIDFATVSRNCRKLHIAQKLLHECFVSIIEPRTQS
DLLADLLMNKESELNRLNFWGFYTMLLVRGDEIISMATFRVFGEKIAEMPLVGTRAKYRR
QGMCHIILDELEKLLSALGVERLCIPAVQTLIETWMSSFGFTKMSNYERLNLLEYTLLNF
QDTIMCQKPLRTAPEVTDENKGKCHQHQDSPNYRLPDIVAILNRGIAIYYLPLCFCHCKL
GK
Download sequence
Identical sequences M0U5G2
GSMUA_AchrUn_randomP01500_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]