SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_AchrUn_randomP06770_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_AchrUn_randomP06770_001
Domain Number 1 Region: 14-137
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000541
Family Ankyrin repeat 0.0015
Further Details:      
 
Weak hits

Sequence:  GSMUA_AchrUn_randomP06770_001
Domain Number - Region: 243-273
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0022
Family CCCH zinc finger 0.0042
Further Details:      
 
Domain Number - Region: 272-317
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0471
Family Anti-platelet protein 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_AchrUn_randomP06770_001
Sequence length 584
Comment pep:novel chromosome:MA1:chrUn_random:28656061:28658196:-1 gene:GSMUA_AchrUn_randomG06770_001 transcript:GSMUA_AchrUn_randomT06770_001 description:"Putative Zinc finger CCCH domain-containing protein 30"
Sequence
MNHLAVEPDDSFSNLLELAANNDVDAFRRSLDRDPSAIDEFGLWYGREKGSNRMVLERRT
PLMVAATYGSLDVLGLLLSLTSSVDINRAAALDGTTALHCAASGGSPSAADAVKLVLSAG
ANPNSVDANGHRPADVVVVPPKLPDVRTALEQLLGRSSNGTVEDHQHCALRAQEIQPPAF
PEKKEYPVDPSLPDIKNSIYATDEFRMYSFKVRPCSRAYSHDWTECPFVHPGENARRRDP
RKYHYSCVPCPDFRKGACTRGDMCEYAHGVFECWLHPAQYRTRLCKDGTNCSRRSANGVS
HSSLAWAQPNVPVLHLPGSNLQASRLRSSLSARDMPSDDFSVMHECDAQQLIDDLCYTRL
SSSLGSRMAPSKTLAPSNLDDLFSAEFASSPKYKSDEGPFFSPSHKAAILGQFQQQQSLL
SPINTVMSPRSMEPISPLNSHSSLYAHWEKQLQTPRSMSSRDLGSGTSLVVSSPVNASWS
NWVSSPSGTFDWGVNGDELGLHKQWPFFELQDNGEEPDLSWVHSLVRESPPEKIGTVSVL
LPGPSRLQPANGVEGSNSDSQPDSLDEAAVVGAFEQMQLDQMVP
Download sequence
Identical sequences M0U6Y8
GSMUA_AchrUn_randomP06770_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]