SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_AchrUn_randomP06800_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_AchrUn_randomP06800_001
Domain Number 1 Region: 56-107
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000182
Family PHD domain 0.0055
Further Details:      
 
Domain Number 2 Region: 2-55
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000399
Family PHD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_AchrUn_randomP06800_001
Sequence length 182
Comment pep:novel chromosome:MA1:chrUn_random:28883400:28888146:-1 gene:GSMUA_AchrUn_randomG06800_001 transcript:GSMUA_AchrUn_randomT06800_001 description:"Putative Histone-lysine N-methyltransferase MLL2"
Sequence
MCRICFSGEIEGSEKAMKMLLCKSCNRKYHRSCLKTLVEHRDLFHWSLWSCPACRICEVC
RRTGDPNKLMYCKRCDGAYHCYCQHPPHKNVSRGPYLCPKHTRCHSCGSTVSGSGLSTRW
FLGYTCCDACGRLFVKGNYCPICLKVLLYYTQVFQLLKGNLGLQFTDYKEDSVNWMRAIY
IL
Download sequence
Identical sequences M0U6Z1
GSMUA_AchrUn_randomP06800_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]