SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_AchrUn_randomP07040_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_AchrUn_randomP07040_001
Domain Number 1 Region: 65-305
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-43
Family Voltage-gated potassium channels 0.0035
Further Details:      
 
Domain Number 2 Region: 309-493
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.05e-37
Family cAMP-binding domain 0.0032
Further Details:      
 
Domain Number 3 Region: 522-667
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.68e-28
Family Ankyrin repeat 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_AchrUn_randomP07040_001
Sequence length 791
Comment pep:novel chromosome:MA1:chrUn_random:30618616:30623599:1 gene:GSMUA_AchrUn_randomG07040_001 transcript:GSMUA_AchrUn_randomT07040_001 description:"Potassium channel AKT1"
Sequence
MAERRKSGLFNVSVPTSCFQEAERELSRDGSHYSLSSGILPSLGARSNRRVKLRSFIVSP
YDRRYRCSWETFLIILVIYSAWVSPFEFGFLEDSRGSLALVDNIVNAFFAIDIMLTFFVA
YLDKATYLLVDDRKKIAWRYLHSWFILDVASTIPSEIARKMLPPKIRSYGFFNMLRLWRL
RRVSALFARLEKDRNFNYFWVRCAKLICVTVFAIHCAGCFYFLLAAKHHDPSQTWIGASM
PDFHEQSLWIQYVTSMYWSITTLTTVGYGDLHAENIGEMIFNTFYMLFNLGLTAYLIGNM
TNLVVHGTRRTRKYRDTIQAATGFAQRNHLPERLQDQMISHLSLKFRTDSEGLQQQETLD
ALPKAIRSSISHYLFYSLVQKVYLFQGVSQDLLFQLVSEMKGEYFPPGEDVILQNEAPTD
FYILVTGTLIVQVAKKGDVLGEIGVLCYRPQLFTVRTRSLCQLLRLNRTVFHSIIQSNIG
DGTIIINNFLQHLKEQVDDPLMEGLLRETESMLTHGRLDLPLTLCFAVIREDDLLLRQLL
KRELDPNESDNNGHTALHIAASKGNEHCVCLLLDKGADPNRRDSEGSVPLWEAILGRHEQ
VAKVLRENGAQLLSGDMGLFACTAAEQNSLELLEDIIRYGGDVTAAAKRDGNTALHRAVC
DGNLQLADQQSHDEIKALFEGKKTSDPISGAPLSSELRRLSSEPIGHSGMLSSVAGPPRP
MLGGSGRGPDKLVLLPDSLQELLDIGSKKFGFSASKVLTADGAEIDDVKLIRDGDRLVLV
GGGSVAATRHD
Download sequence
Identical sequences M0U715
GSMUA_AchrUn_randomP07040_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]