SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_AchrUn_randomP07840_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_AchrUn_randomP07840_001
Domain Number 1 Region: 338-367,558-729
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.16e-23
Family G proteins 0.00062
Further Details:      
 
Domain Number 2 Region: 367-413,442-523
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 7.33e-20
Family Transducin (alpha subunit), insertion domain 0.0019
Further Details:      
 
Domain Number 3 Region: 115-190
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000453
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_AchrUn_randomP07840_001
Sequence length 755
Comment pep:novel chromosome:MA1:chrUn_random:32710866:32722590:-1 gene:GSMUA_AchrUn_randomG07840_001 transcript:GSMUA_AchrUn_randomT07840_001 description:"Putative Guanine nucleotide-binding protein alpha-2 subunit"
Sequence
MTDTMDASSWQEMLRRILPPGTPIPEAPANLDYSIAIEYDGPPVSYELPRVDPVDLIPTA
ETAPGSHSSSVDSVLQNEEFSDASRSDSPVSTHSVPNGQPSQPVNEERRTSVVTFEEKSE
SKELYSDLSGSTRDVGVTRREKRKRVCYRCGKRKWESKEVCLVCDARYCSYCVLRAMGSM
PEGRKCVSCIGQPIDESKRLRLGKSSRTLSRLLSPLEEGEKPNRIISSNLNFTGKLHADA
SNGNTEVYINGREITKIELKVLKLANVQCPRDTHFWVYDDGRYEEEGQNNIRGNIWESTL
TRLACSLFSLPVPHPVPNDHKNVAPYVARPVPDYLEQRIQKLLLLGPQGSGTSTIFKQAK
FLYGNKFSQEELENIKLMIQSNMYKYLSILLEGRERFEEEALARLEGTGSHDQHPSEGVS
GQHKSEASQPNLCIYSINGRLKQFSDWLLDIVAMGDLDAFFPAATREYAPLVDEMWREPA
IQETYKRRNELHYLPDIAGYFLSKAIEVSSNEYEPSEKDILYAEGVTQGNGLACIEFSLD
DHSPMSEPYNDNHDAYSQPLTKYQLIRVSVKGMNEGCKWVEMFEDVRLVIFCVSLGDYDQ
LAADVNDSSKPLRNKMMQSKELFEATVRQPCFQDTPFVLVLNKYDLFEEKINRVPLSACE
WLNEFSPVKTNQNSQSLAHQAYYYIAMKFKDLYLSITNRKLFVWQARARDRPTVDEAFKY
MREVLKWANERDENCIEDSFYSTTEMSSSPFIRQE
Download sequence
Identical sequences M0U795
GSMUA_AchrUn_randomP07840_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]