SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_AchrUn_randomP08820_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_AchrUn_randomP08820_001
Domain Number 1 Region: 432-488
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.65e-17
Family PHD domain 0.01
Further Details:      
 
Domain Number 2 Region: 533-588
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000687
Family PHD domain 0.0047
Further Details:      
 
Domain Number 3 Region: 682-777
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000986
Family N-acetyl transferase, NAT 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_AchrUn_randomP08820_001
Sequence length 815
Comment pep:novel chromosome:MA1:chrUn_random:40309536:40329143:1 gene:GSMUA_AchrUn_randomG08820_001 transcript:GSMUA_AchrUn_randomT08820_001 description:"PHD-finger domain containing protein, expressed"
Sequence
MDSAGGPPDSEDFVLRSAVRSGLKREFVFALRSQAQLPSSLGRTRSGRSAAAPAAFPPRA
TKKRRKSGGDLPLKTAATVTDVVDCDDEPPVRRFTRSLLKVPPSEEEDSGSDVGAGVSGE
STGSEGTKGGENSVNGSLNSTPKNKMELKMSKKISLTKLPGNVRELLSTGLLEGLPVKYM
TSNGKQIELHGVIKGNGILCSCATCDSSIVVSAYVFEQHAGSTKKHPADFIYLQNGNSLH
DVVKACHGAPLDMLEAAIQGAIGPVPPKKCFTCQKCKVSFSTSRVGKFAWLCDLCLELKQ
LSRTPSPLNGVVSSTRLSRTSSTPDMSNNSSKNLLSIKKSSLGRLTRKDLGLHKLVFMSG
ILPEGTEVGYYVRGKRLLEGYIKDSGIYCRCCNTVVSPSQFEAHAGRAARRKPYNNIYTS
NGVSLHELSVSLSKDRKLSANENDDLCSICADGGDLLLCDLCPRAFHTGCVGLPSIPVGD
WYCQYCINLHQRERSVACNDNAIAAGRVAGVDPIEQIFKRSIRIVTTSQTDAGGCAFCRS
HDFSKSRFDDRTVMICDQCEKEYHVGCLREQMMADLKELPEGEWFCCDDCSRIWNSLQEF
LFRGTQPLPELNTDIIKKKLENKGVNGDADVDIRWRLLSGKTDTADSKLLLSRAVAIFHE
SFDPIIEATTGRDLIPSMVYGRTVRDQDFGGMFCAVLTVGSSVVSAGILRVLGSEIAELP
LVATSREHQGQGYFQSLFSCIERLLGSLNVKHFLLPAADEAESIWTKKFGFTKITLDQLH
KFLNGARTTVFEGTSMLHKSIPAIPVSSQVEPAVN
Download sequence
Identical sequences M0U7J2
GSMUA_AchrUn_randomP08820_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]