SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_AchrUn_randomP09300_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_AchrUn_randomP09300_001
Domain Number 1 Region: 340-729
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.72e-93
Family Regulator of chromosome condensation RCC1 0.00099
Further Details:      
 
Domain Number 2 Region: 8-114
Classification Level Classification E-value
Superfamily PH domain-like 2.67e-25
Family Pleckstrin-homology domain (PH domain) 0.0027
Further Details:      
 
Domain Number 3 Region: 728-804
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.97e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_AchrUn_randomP09300_001
Sequence length 1153
Comment pep:novel chromosome:MA1:chrUn_random:43222677:43232560:1 gene:GSMUA_AchrUn_randomG09300_001 transcript:GSMUA_AchrUn_randomT09300_001 description:"Putative Probable E3 ubiquitin-protein ligase HERC1"
Sequence
MNDIEMYILVALKKGTQLLKYGRKGKPKFYLFRLSNDESTLIWFSTSGERTLKLASVSRI
ISGQRTSVFQRYPRPDKDYLSFSLIYNDGKRSLDLICKDKVEVEVWFSGLKTLISAGQYG
RPKIDGWSNGLYNDNRRRKEEGGRRKNRRQWRKRRKDGERKDEDETVEEKEEKEKGRRGD
AKSDLEVVVGHLHAHWIMPCFTTPEKWNNIYLHKEFACLEAHEKTFFLKAPRINHPIKNL
SCFISGSCQPEASYRLFDSHEFASDNISNHSIGPTLDTSEDRLTSCGLQKIQSFEYPVYS
ERSDVSNMHTKGASSDGIRISTSSVPSTSSHGSAPEDFDASGDVYVWGEVISDISARVSA
DRNSNPSSARTDVLLPKSLESNLVLDIHHVACGVRHAALVTRQGEVFTWGEESGGRLGHG
VAADTVNPRLVESLSASNVDFVACGEFHTCAVTMSGELYTWGDGSYNAGLLGHGTDVCHW
MPKRVSGILEGLQVSYVSCGVWHTALITTTGQLFSFGDGTFGVLGHGNRESLLHPREVES
LTGLKTMAVSCGVWHTAAVVEVIVTQSSASSGKLFTWGDGDKHRLGHGDKEPQLEPTCVS
SLIDFNFHKLACGHSLTVGLTTSGHVFTMGSTVYGQLGNPHSDGRLPCMVEDKLLGESVV
EVASGSYHVAVLTARGEVYTWGRGANGRLGHGDLEDRKTPKMVEALKDRHVKHISCGSSF
TAAICQHKWVSGTEQSQCSACRQAFGFTRKKHNCYNCGLVHCHQCSSRKALRAALSPNPG
KPYRVCDTCYVKLTNSFDSGGFISKKIMKPRISGESKDRLDRLDTSLSKALPSSNLDLVN
NFDSKVSIEGKNSNSLSVTQSPQVPSVLQLKSIAFNASTDVHQAVPRPAVKSTNRSRAVS
PFSRKPSPPRSTTPTPTMAGLSFSKSFSDNLKKTNDILNQELLRFHSEVDNLRQRCERLE
FQLEKSEKKAQEATTLAMEESAKSKAAKEVIKSLTAQLKEMAKRLPQGVYDTDPIKLMHL
SNGSTDSHAIQQSDSSFGNLSSNGTSDFTCSNYLEDLSNVEHNGNGEMPVTITRSEDLDS
PNSDSNQVEAEWIEQFEPGVYITLIALRDGTRELKRVRFSRRRFGEQQAEAWWSENAERV
HDKYKFRGLNSTL
Download sequence
Identical sequences M0U7P0
GSMUA_AchrUn_randomP09300_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]