SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_AchrUn_randomP11680_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_AchrUn_randomP11680_001
Domain Number 1 Region: 763-825
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000775
Family PHD domain 0.0038
Further Details:      
 
Weak hits

Sequence:  GSMUA_AchrUn_randomP11680_001
Domain Number - Region: 825-875
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00062
Family PHD domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_AchrUn_randomP11680_001
Sequence length 1007
Comment pep:novel chromosome:MA1:chrUn_random:56444321:56458337:1 gene:GSMUA_AchrUn_randomG11680_001 transcript:GSMUA_AchrUn_randomT11680_001 description:"Hypothetical protein"
Sequence
MLFGQGMDRMDRDGFDGSKQEHHIFMEVFSVTSVDTASNHNIALNTMDLQKDEGSQSKLV
ESSNCESSVLTSSFSTKDSSGEASQPACVYARQVSGSRCFADISSCCGVADPYDADIKCM
KVSSIEQQNHKSVMQSYSLSVTGDDLLDLDRLQNSSSMLMQRQQQSPCLVIETCSHDILS
SCYLSKTNKEIDGSDDMDDGNALDIECKSQDIRDDKIIIEAKSVTSPVSQESFASGLLVV
NAAAAPAETPGVPIHMKHIVEESSILNSGSTDVASKRALIRELPERLRLHTNRLLTDAGW
KIEPRVRSDRTKLASYYIAPKEKLVVTSLSQAWKACGRRLYSSAMDSELEDNGREWTNID
RFWSDLTDTLFYVEENTQSTKISISLLKRWQLLDPFVAVVCINRKVGVLREGKSLKAVSS
ATFILSEDVDERLATQPSDLIPGCEDGLLASNIHSDIITEKVAIKASESKDQNFSVNQVS
DSGKKVHKKSKKISEIRASKVDGTNDEKSMEALNFRFDDRSNDYTETQCNQEDSQTLAFE
STLGCMKENTCATVEDCSNVKKKMVKSESKAPRQHLKGRKGKFAMSLVNKEAIVAPDDGN
TSTGGKTINAEVLCSDNPTEENKKLSKPKVPEACKKRKWKRPRGFRINDDDLLIAAIIKN
KDYISYGKGINLGARSVLCWLIDRGVLSLKDVLQYRNPKNNALVKDGWITRDGILCKCCM
EIFSVSAFKAHSGSKFQKPSSNLFLQSGRSYTLCQLQAWSADYKARKGRKRDMRVEEVDQ
NDDTCGLCIDGGELICCDNCPSTYHQTCLTIQVLPEGSWYCHNCICKSCGDVVDATTSSS
FAVLECSQCEHKYHGTCVKKRNLGSGEVESGTWFCGKKCKEVYLGLRSHVGILNCLADGF
SWTILRCNHDDQKINSTQKIALMAECNTKLAIALSIMEECFLPMVDPRTHIDMIPHVLYN
RGSNFTRLNYQGFYTVVLEKSDEVISVASIRYVANSFASLKTFSCRL
Download sequence
Identical sequences M0U8C7
GSMUA_AchrUn_randomP11680_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]