SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_AchrUn_randomP12630_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_AchrUn_randomP12630_001
Domain Number 1 Region: 63-125
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.65e-18
Family PHD domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_AchrUn_randomP12630_001
Sequence length 128
Comment pep:novel chromosome:MA1:chrUn_random:60527451:60528221:-1 gene:GSMUA_AchrUn_randomG12630_001 transcript:GSMUA_AchrUn_randomT12630_001 description:"PHD finger protein At5g26210"
Sequence
MINNLPTIYEVVTGTTKRQFKEKTSNSSSKNKSSSKMSRPAESQTKALRMPTPKEDEDSG
ADEEEDEQEHENTLCGACGDNYANDEFWICCDVCERWFHGKCVKITPARAEHIKQYKCPS
CSNKRARA
Download sequence
Identical sequences M0U8M2
GSMUA_AchrUn_randomP12630_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]