SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_AchrUn_randomP14010_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSMUA_AchrUn_randomP14010_001
Domain Number - Region: 111-158
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00489
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_AchrUn_randomP14010_001
Sequence length 263
Comment pep:novel chromosome:MA1:chrUn_random:65840867:65843407:1 gene:GSMUA_AchrUn_randomG14010_001 transcript:GSMUA_AchrUn_randomT14010_001 description:"Putative Predicted protein"
Sequence
MGDKTTIARARQELENLYLGVPDDSVDLSFKDLTSFQATMSPIHEEPKAAVTKSPSLDFA
KGLRGTKSGSDSAAEHELRRERLAPDAVSVVSMASAVRGETGRRRRPGIPHSNICALCSV
YIYVFRHRCLVCGRVYCRDCVGIGMGDMSEGRKCVECLGRRFCQRYIKRAGHAWCCWRYP
SRVKLQELKWAEKGPRRSGERRYRSQAVSAVGPRLLHASRSGSPSVAATPRPPAAATPGR
FGISHDSSVVSFMRSPSPHGFPL
Download sequence
Identical sequences M0U910
GSMUA_AchrUn_randomP14010_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]