SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_AchrUn_randomP14800_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_AchrUn_randomP14800_001
Domain Number 1 Region: 141-212
Classification Level Classification E-value
Superfamily RING/U-box 1.7e-22
Family RING finger domain, C3HC4 0.0043
Further Details:      
 
Weak hits

Sequence:  GSMUA_AchrUn_randomP14800_001
Domain Number - Region: 4-32
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0652
Family PHD domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_AchrUn_randomP14800_001
Sequence length 259
Comment pep:novel chromosome:MA1:chrUn_random:69752426:69754464:1 gene:GSMUA_AchrUn_randomG14800_001 transcript:GSMUA_AchrUn_randomT14800_001 description:"Putative zinc finger, C3HC4 type domain containing protein, expressed"
Sequence
MSRANTHWCYICRQTVLPLGRDMICPNCDRGFVQDLNELDGSMNTFDYFGVDYRGNRNDQ
FGIIDALSALIRQQMEGRSHEFDLHGRPSNRGIEIIFNGGAGVGMRHANIGNYARGSGFN
DLIEQLIRNDGHGPPPASQSAIDAMPTVKINQRHLRGDSHCPVCKEKFELGTEARELPCK
HLYHSDCIIPWLVRHNSCPVCRHRLPSQESTRRNLFSFLWPYYTSNTANSSSNESSRSSS
TAVHEDINQMHYTGWPFDY
Download sequence
Identical sequences M0U989
GSMUA_AchrUn_randomP14800_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]