SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_AchrUn_randomP21240_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_AchrUn_randomP21240_001
Domain Number 1 Region: 253-444
Classification Level Classification E-value
Superfamily PUA domain-like 2.73e-68
Family SRA domain-like 0.00000324
Further Details:      
 
Domain Number 2 Region: 142-199
Classification Level Classification E-value
Superfamily RING/U-box 1.33e-16
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Domain Number 3 Region: 515-603
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000102
Family RING finger domain, C3HC4 0.0071
Further Details:      
 
Domain Number 4 Region: 3-61
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000126
Family PHD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_AchrUn_randomP21240_001
Sequence length 711
Comment pep:novel chromosome:MA1:chrUn_random:103595937:103606558:-1 gene:GSMUA_AchrUn_randomG21240_001 transcript:GSMUA_AchrUn_randomT21240_001 description:"E3 ubiquitin-protein ligase ORTHRUS 2"
Sequence
MAPDLPCDGDGVCMVCRAPPPEAEVVNCHTCTTPWHAGCLSKPLETLAAVADWQCPDCSP
LEDGGAALPAAAAYASGEKSDLISAVWAIEADASLTEREKAKRRQALVSGKKVVEEEEEE
EEEEEGGKKKKKKKAEGGDDVLDLLDEKFNCSFCLQLPERPVTTPCGHNFCLKCFQKWVG
QGKHTCAKCRFSIPPKMVSQPRINSALVVAIRMAKAAKSATSGGQTNVYHFIRNESRPEK
AFTTERAKKAGKANACSGQIFVTIAPDHFGPILAENDPKRNLGVLVGEMWEDRMECRQWG
AHFPHVAGIAGQSDYGAQSVALSGGYEDDEDHGDWFLYTGSGGRDLSGNKRTNKEQAFDQ
KFEKLNAALRVSCLKGYPVRVVRSHKEKRSSYAPESGVRYDGIYRIEKCWQKVGVQGYKV
CRYLFVRCDNEPAPWTSDEHGDQPHPLPSVKELNSATDITERKESPAWDFDVKHGWRWVK
SPPTSRKPVTSSDTDGKKGGRKAVRHAHKLSVRERLLKEFSCLLCRKVMTQPLTTPCGHN
FCKSCLLEAFTDKSFVRERICEGGRTLRAQKIVKRCPSCSTDISDFLWNPQVNRDLMDLI
ESLEDKTEEEKVEQQIEDDTSEEGCSSANDTEEAAEEATEVQDIKLSKEESDNLENGKLD
AAEGDSQVNVLGEKDGAEDTIDATNSELSCKRKNHLACRRGVKRTRNSESQ
Download sequence
Identical sequences M0UB32
GSMUA_AchrUn_randomP21240_001 XP_009387841.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]