SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_AchrUn_randomP23720_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_AchrUn_randomP23720_001
Domain Number 1 Region: 1-42
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000509
Family PHD domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_AchrUn_randomP23720_001
Sequence length 532
Comment pep:novel chromosome:MA1:chrUn_random:116628504:116636388:1 gene:GSMUA_AchrUn_randomG23720_001 transcript:GSMUA_AchrUn_randomT23720_001 description:"protein binding protein, putative, expressed"
Sequence
MVCCDVCERWVHCLCDSISDEKYQQFQADQNLQYKCAACRGDCYQVEDIDDAVRELWKRK
DIADNDLIASLRAAAGLPSHEVTYSISPYSGDEQSGPIILKNDNNKPLKFSLKGISDKSS
EYENTTSNKKQVKKKGYWIKLVGKTEEAYPELDKQDETRSLECRYRDQNIDEMTTFRPDG
PDILSSSAARDPNGNGVKSCTNQLGTFDQSMAKEPASSNADMIPKVKIKSSKLQGLHFKE
CADKSANKIETTRSTKLVIHIGSINRNASNSPKSETSSCHKDQDLVNCFGAKMVNANVMR
TPKHGVKEKTKVKIGKVYVKPQKSNGNVTDECDLNATDLSVERMNEANFAAENDTTERSN
KVCQKKHSADIYVKPQRDSSEMSPSDFTSSSSKDLKTSLKLKFKNPCFEQKSSWAPHGEE
DNTVKGQRSKRKRPSTEKMGGWQDDRSSKLHLENLIDEAMDANWILQKLGKDAIGKRVEV
QPTNSSWHQGVVIDVNQSTSSLSVHLDDGRSTLLELGKQGLRFISQKQRTKS
Download sequence
Identical sequences M0UBT0
GSMUA_AchrUn_randomP23720_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]