SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_AchrUn_randomP28620_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_AchrUn_randomP28620_001
Domain Number 1 Region: 521-557
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000349
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 
Weak hits

Sequence:  GSMUA_AchrUn_randomP28620_001
Domain Number - Region: 651-685
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.024
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_AchrUn_randomP28620_001
Sequence length 736
Comment pep:novel chromosome:MA1:chrUn_random:138738532:138740739:1 gene:GSMUA_AchrUn_randomG28620_001 transcript:GSMUA_AchrUn_randomT28620_001 description:"Putative polyprotein"
Sequence
MMTVGDFYRNIQLSILTRGYDTWQNGEANLLITRGMVGRLSNTPNVAFAYEISGVVDYLT
SHGVRALPGRRYSTADIRGRDWTIRPTQVSIPIQPAELRSRNLIDGRISISFDNYKAAST
SSRIHYSNADDETFSDEEEIRSHVIAVNIQLSYESENEAEELQENLNCYFQNIYTSNEEV
EMPYPQKPQKELIAAGLEEDLVMEYPQLAKLSHQVYSSSAISNYRPPADSTMGPVNYPPA
VNIESTSQRPEYEGGSRRPRFKAKSFSEAWNLPSAFQQQGAIFIIPSQLGMFDEVFMRWE
SITKNLVSLQGFTDPLAKMEFIENLLGEAEKLAWIQWRMAYPEEYQLLIANADGTGGTQN
ILSQLRTIFILEDPFQGSTTAQEEAYRDLERLSCTNLKHIIQFLNDYMRLASKTGRMFLG
PELSEKLWSKMPGELGKRIKEAFEAKYRGNTIGVIPRILFSYKYLEAECKDAAFRRALKD
LSFCSEIPIPGYYNKPERKYGVRRSTTYKGKPHSSHARIEKRKHLLRNKKCKCYLCGEEG
HFARECPNDRKNIKRVAMFEQLDIPEDYEILSVQEGENQSDAIYSISEGEDIEDLQHGIH
SFTHKIFALIEDSRTWWIGPDTGYRARIQVSQEQAECRHIWEINTELPPTLEECKCCKRK
SQRRHRRHCPLCKITSCGMCSIYYFDKRTPVMMEEPPRYEPKNLLQTQQDFINHCEAEIR
RLKLAVEFEQQKSKEL
Download sequence
Identical sequences M0UD70
GSMUA_AchrUn_randomP28620_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]