SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr11P06170_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr11P06170_001
Domain Number 1 Region: 158-219
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000294
Family B3 DNA binding domain 0.00089
Further Details:      
 
Domain Number 2 Region: 42-90
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000000523
Family GCC-box binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr11P06170_001
Sequence length 336
Comment pep:novel chromosome:MA1:11:4812860:4813975:1 gene:GSMUA_Achr11G06170_001 transcript:GSMUA_Achr11T06170_001 description:"Hypothetical protein"
Sequence
MATAVPAAREGPDSSCIFWGRASPFMAAATGTSNDPNPSTPYRGVMLLPDGHWGAQIYAR
GHRVWLGRFESEIAAAGAFDSAAVKLHHGDYSHRNLPATRHAAHERRFQETFSIDDVLDM
IRDGSYCSRLEEYTRLHAAPIRDLPHARTTSNVTFLEMFVKELTPSDVGKLNRLVIPKKH
ATHQSYVFTKGWNKFVKEKRLQAKDTVAFYRCEESDGHRRTYCMIDIIRHNSGGDRSGGS
SRSTSGVIGLGLGFKRKKMENGDEEDHCSCGFSRRKSGVMGVGLDLSLERVTAKKDDEGG
VVTGSAAPRKSSETQDKKKGLKLFGVWIADENDRRG
Download sequence
Identical sequences M0RPU7
GSMUA_Achr11P06170_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]